# LL-37 (Human Cathelicidin): Amphipathic Alpha-Helical Architecture, Bacterial Membrane Lysis, and Reconstitution Mechanics

## Key Takeaways

- **Primary Biochemical Mechanism:** LL-37 is a 37-residue, +6 net charge amphipathic alpha-helical cathelicidin (MW ~4493.34 Da) generated by MMP-9 and neutrophil elastase cleavage of hCAP18 at the V104-L105 bond; its central K10-R29 helix segregates cationic and hydrophobic residues on opposing faces, enabling electrostatic attraction to anionic bacterial membranes, LPS/LTA neutralization via lipid A binding, and toroidal pore formation that disrupts membrane potential and causes osmotic lysis.
- **Receptor Selectivity & Signaling:** LL-37 engages multiple host receptors with biased downstream effects, including FPRL1 (formyl peptide receptor-like 1) for chemotaxis, EGFR transactivation for keratinocyte migration, P2X7 for IL-1beta release in macrophages, and TLR (TLR2, TLR4, TLR9) modulation; receptor binding kinetics are concentration-dependent and selectively coupled to MAPK/ERK, PI3K/Akt, and NF-kappaB pathways that reorient signaling toward pro-resolution, wound healing, and immunomodulatory outputs rather than direct antimicrobial lytic activity at sub-micromolar doses.
- **Pharmacokinetics & Structural Stability:** The peptide exhibits serum half-life of approximately 1-2 hours due to rapid proteolytic degradation, hepatic/renal clearance, and plasma protein binding; helical content is environment-dependent, reaching maximal stability (>60% helicity) in membrane-mimetic solvents and acidic pH, while serum, high salt (>150 mM NaCl), and divalent cations (Mg2+, Ca2+) attenuate membrane binding affinity and antimicrobial potency through charge screening and conformational destabilization of the disordered N- and C-terminal flanking regions.
- **Volumetric Reconstitution Dynamics:** Reconstitution requires calculating diluent volume using C = n/V, where n = vial mass (mg) divided by molecular weight (4493.34 g/mol) and C = desired molarity; standard laboratory practice dissolves lyophilized LL-37 in sterile, endotoxin-free water (1-5 mg/mL stock) followed by dilution into PBS or 0.01% acetic acid for working concentrations, noting that peptide mass refers to peptide content (not salt-adjusted gross weight) and that final working concentrations typically range 1-50 micrograms/mL for in vitro assays.
- **Structure-Activity Relationships and Functional Determinants:** Truncation studies reveal the helical core (residues 7-31) preserves antimicrobial activity, while the disordered C-terminal tail (L31-S37) is dispensable for lysis but essential for LPS detoxification, chemotaxis, and IL-8 induction; alanine scanning demonstrates K10, R19, R23, and R25 are critical for membrane binding, and F6, I13, V17, I20, L21, and V28 anchor hydrophobic insertion, making residue-specific substitutions key tools for dissecting lytic versus immunomodulatory phenotypes.

> **Academic Research & Educational Disclaimer:** This scientific monograph is published exclusively for academic research, molecular biology education, laboratory investigation, and informational reference. Unapproved synthetic peptides discussed herein are intended strictly for in vitro and controlled preclinical laboratory research by qualified scientific investigators and are not intended for human consumption, direct medical self-administration, diagnostic application, or therapeutic use without direct medical supervision and valid clinical authorization. All concentration and volumetric calculations derived from the [Peptide Reconstitution Calculator](/tools/peptide-calculator) represent theoretical laboratory mathematical models based on molarity, vial mass, and diluent volume, and do not constitute clinical prescribing advice or human dosing recommendations.

## Discovery, Natural Biosynthesis, and Structural Architecture of LL-37 (Human Cathelicidin)

### Historical Context and Gene Locus Identification

The human cathelicidin antimicrobial peptide LL-37, the sole known cathelicidin expressed in humans, was originally isolated from bone marrow and neutrophil granules, revealing a 37-residue C-terminal peptide generated from the larger 18 kDa precursor protein designated human cationic antimicrobial protein of 18 kDa (hCAP18), which is encoded by the *CAMP* gene located on chromosome 3p21.31. The structural biology of LL-37 fundamentally shaped understanding of how linear host-defense peptides execute potent antimicrobial and immunomodulatory activities without overt cytotoxicity against eukaryotic membranes. Within the body, the inactive pro-form hCAP18 is constitutively expressed in epithelial tissues and is stored in the secondary granules of neutrophils, where matrix metalloproteinases, specifically MMP-9 and neutrophil elastase, execute precise proteolytic cleavage at the V104-L105 peptide bond to liberate the biologically active C-terminal LL-37 fragment into the extracellular milieu [1, 2].

### Primary Sequence Composition and Helical Domain Mapping

The mature LL-37 peptide sequence corresponds to **[LL-37, 37 aa]**, comprising 37 amino acids with a calculated average molecular weight of 4493.34 Da. The primary sequence of LL-37 peptide is highly enriched in cationic and hydrophobic residues, conferring an overall net charge of +6 at physiological pH and a hydrophobic ratio of approximately 35 percent, which underlies its amphipathic character. Biophysical characterization demonstrates that the N-terminal residues (L1-L4) and C-terminal residues (R29-S37) are relatively disordered in solution, whereas the central residues spanning F6-R29 adopt a stable, monomeric **alpha-helical conformation** when exposed to membrane-mimetic environments, such as SDS micelles, dodecylphosphocholine (DPC) liposomes, or trifluoroethanol (TFE). The alpha-helix spanning residues K10 to R29 contains multiple cationic residues (K10, K12, K15, R19, R23, R25, K27) clustered along one face of the helical wheel projection, while hydrophobic residues (F6, I13, V17, I20, L21, L24, V28) project onto the opposing face, generating the prototypical amphipathic helix required for membrane engagement.

### Three-Dimensional Amphipathic Helical Topology

High-resolution structural analyses using nuclear magnetic resonance (NMR) spectroscopy and circular dichroism (CD) spectroscopy have established that LL-37 folds into an extended alpha-helix containing a characteristic flexible kink centered around residues G14-E16, which functions as a hinge region that enhances conformational adaptability during membrane insertion. In aqueous solution, the peptide remains largely unstructured, displaying characteristic random-coil CD signatures with a strong negative ellipticity minimum near 200 nm; however, upon binding to anionic lipid bilayers or in hydrophobic solvents, the CD spectra undergo a marked transition to alpha-helical geometry, marked by double minima at 208 and 222 nm. The segregation of hydrophilic and hydrophobic residues across opposite faces of the alpha-helical cylinder creates a non-polar wedge that permits the peptide to integrate into the hydrophobic core of bacterial membranes while concurrently maintaining electrostatic interactions with anionic phospholipid headgroups, including phosphatidylglycerol (PG) and cardiolipin, which dominate the outer leaflet of bacterial cytoplasmic membranes.

### Biosynthetic Regulation and Tissue Distribution

The biosynthesis of hCAP18/LL-37 is regulated at multiple levels, with transcriptional activation of the *CAMP* promoter driven by vitamin D3 (1,25-dihydroxyvitamin D3) acting through the vitamin D receptor (VDR) and a downstream VDRE response element located within the gene promoter region. Additional transcriptional stimuli include bacterial lipopolysaccharide (LPS), short-chain fatty acids (butyrate), and inflammatory cytokines such as IL-6 and IL-1β, which converge on NF-κB and AP-1 responsive elements to upregulate gene expression in keratinocytes, lung epithelial cells, gastrointestinal Paneth cells, and circulating neutrophils [3, 5]. At the protein level, hCAP18 is abundantly expressed in the bone marrow, epididymis, and squamous epithelia, and following secretion, the holoprotein remains bound to lipopolysaccharide-binding protein (LBP) in plasma until proteolytic processing occurs in inflamed or infected tissues. Beyond neutrophilic storage, LL-37 expression has been documented in macrophages, where IL-33 stimulation of the ST2 receptor induces robust upregulation, linking innate antimicrobial peptide release to type 2-associated cytokine networks during allergic airway inflammation and tumor-microenvironment remodeling [3].

### Reconstitution Mechanics and Aggregation Behavior

A critical aspect of LL-37 biochemistry involves its concentration-dependent oligomerization behavior, which profoundly modulates both antimicrobial potency and cytotoxic thresholds. At concentrations below 5 μM, LL-37 exists predominantly as a monomer that adopts the flexible, monomeric alpha-helical topology described above; however, at concentrations exceeding the critical oligomerization threshold (typically 15-30 μM in physiological salt), the peptide self-associates into tetrameric bundles stabilized by intermolecular hydrophobic packing and electrostatic networks. Analytical ultracentrifugation, size-exclusion chromatography coupled to multi-angle light scattering (SEC-MALS), and analytical gel filtration consistently report the formation of homotetramers in which the four alpha-helical monomers align in an antiparallel orientation, burying their non-polar faces while projecting their cationic residues outward to engage additional membrane substrates. This tetramerization is functionally significant because it increases the local cationic surface area and hydrophobic depth available for membrane disruption, thereby elevating the bactericidal activity against Gram-positive and Gram-negative organisms by approximately one to two log units. In contrast, the same self-association phenomenon at higher peptide concentrations amplifies cytotoxic activity against host cells, explaining the narrow therapeutic index that has motivated the development of synthetic LL-37 analogs, including the ceragenin family and conformationally constrained peptidomimetic derivatives designed to retain antimicrobial function while attenuating host-cell membrane permeabilization. Recent biochemical work has further demonstrated that LL-37 peptide interacts with circulating apolipoprotein B-100 in human plasma to form a stable LL-37-ApoB-100 complex, a finding that has motivated the deployment of this complex as a biomarker of coronary artery disease and that mechanistically links cathelicidin biology to lipoprotein clearance pathways and hepatic cholesterol handling [1, 2].

## Receptor Pharmacology, Binding Affinity Kinetics, and Intracellular Second Messenger Cascades

### Receptor Pharmacology, Binding Affinity Kinetics, and Intracellular Second Messenger Cascades

The **ll 37 peptide** (LL-37), the sole human cathelicidin derived from the proteolytic cleavage of the 18 kDa hCAP18 precursor protein by serine proteases such as proteinase 3, exerts its pleiotropic immunological effects through a highly promiscuous receptor profile. The mature peptide comprises 37 amino acid residues ([LL-37, 37 aa]), adopting an amphipathic α-helical conformation under physiological salt and pH conditions. Its molecular weight of 4493.24 Da and its net charge of +6 at physiological pH dictate its binding kinetics with multiple pattern recognition receptors (PRRs), G protein-coupled receptors (GPCRs), and receptor tyrosine kinases. The receptor pharmacology of LL-37 is uniquely dependent upon peptide concentration, oligomerization state, and the lipid composition of the target cell membrane, allowing this single cathelicidin molecule to mediate both innate antimicrobial defenses and complex immunomodulatory signaling cascades.

### Formyl Peptide Receptor (FPR) Family Interactions

LL-37 acts as a high-affinity agonist for the **Formyl Peptide Receptor** family, particularly **FPR2/ALX** (formyl peptide receptor 2 / lipoxin A4 receptor). Utilizing heterologous cell systems expressing recombinant FPR2, investigators have established that LL-37 binds this receptor with an EC50 typically ranging from 0.3 to 1.5 µM, depending on assay conditions and receptor polymorphisms. This interaction triggers downstream Gαi/o protein activation, leading to the inhibition of adenylate cyclase activity and a subsequent decrease in intracellular cyclic adenosine monophosphate (cAMP) concentrations. Parallel to this Gαi signaling, LL-37 activation of FPR2 initiates Gαq/11-mediated phospholipase C beta (PLCβ) stimulation, generating inositol trisphosphate (IP3) and diacylglycerol (DAG) second messengers. These events provoke the release of intracellular calcium stores, the activation of protein kinase C (PKC) isoforms (particularly PKCα and PKCβ), and the activation of mitogen-activated protein kinase (MAPK) cascades. The dual Gi/q coupling of FPR2 is particularly notable, as it allows LL-37 to orchestrate convergent signals toward extracellular signal-regulated kinase 1/2 (ERK1/2) phosphorylation while simultaneously modulating cytoskeletal reorganization and neutrophil chemotaxis.

Additionally, LL-37 has been characterized as a low-affinity ligand for **FPR1**, with reported EC50 values in the micromolar range (typically 5 to 15 µM). FPR1 activation by LL-37 preferentially signals through Gαi proteins and β-arrestin recruitment, providing a biased agonism profile that may fine-tune leukocyte recruitment during bacterial infection. The peptide's capacity to induce receptor internalization via clathrin-dependent endocytosis following agonist binding further complicates its pharmacological footprint, as prolonged LL-37 exposure can lead to FPR2 desensitization and recycling kinetics that differ significantly from those of conventional FPR2 agonists such as the annexin A1-derived peptide Ac2-26.

### P2X7 Purinergic Receptor and NLRP3 Inflammasome Modulation

A critical pharmacological target of LL-37 is the **P2X7 receptor** (P2X7R), a ligand-gated cation channel expressed predominantly on macrophages, monocytes, and dendritic cells. LL-37 binds the extracellular domain of P2X7R with a Kd estimated at 0.5 to 2.0 µM, functioning as a non-competitive allosteric modulator that potentiates ATP-induced currents. The P2X7R is a trimeric ion channel permeable to Na+, K+, and Ca2+; LL-37 binding lowers the threshold for ATP activation and can directly induce channel opening at high peptide concentrations (greater than 5 µM). The resulting calcium influx and potassium efflux trigger downstream signaling cascades, most notably the activation of the **NLRP3 inflammasome**, which culminates in caspase-1 activation and the proteolytic maturation of pro-IL-1β and pro-IL-18 into their bioactive secreted forms. This mechanism has been demonstrated to amplify inflammatory responses during *Neisseria meningitidis* urethritis infections, where LL-37 concentrations are locally elevated, contributing to the immunopathology associated with invasive bacterial pathogens [4]. However, the LL-37 / P2X7R interaction is highly context-dependent, as LL-37 can also exhibit inhibitory effects on P2X7R under conditions of receptor overstimulation, functioning as a functional antagonist to prevent excessive pyroptosis.

### Toll-like Receptor Crosstalk and TLR4 Activation

LL-37 engages **Toll-like receptor 4** (TLR4) through a mechanism that remains structurally debated. The peptide does not bind the canonical lipopolysaccharide (LPS) binding pocket but rather interacts with the accessory protein CD14 and the extracellular domain of TLR4, facilitating receptor dimerization and subsequent MyD88-dependent signaling. LL-37-induced TLR4 activation drives the canonical nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) pathway via IRAK1/4 and TRAF6 ubiquitin ligase activity, resulting in IκBα phosphorylation, degradation, and nuclear translocation of the p65/p50 transcription factor complex. This signaling axis induces the transcription of proinflammatory cytokine genes (TNF-α, IL-6, IL-1β), chemokines (CXCL8/IL-8, CCL2), and antimicrobial peptides. Concurrently, LL-37 activates the TRIF-dependent (MyD88-independent) pathway, leading to the phosphorylation of IRF3 and the production of type I interferons.

LL-37 has also been reported to bind TLR3 and TLR9, though these interactions appear to be primarily immunomodulatory rather than directly activating. Through TLR9 engagement, LL-37 can act as a competitive inhibitor of CpG DNA binding, effectively dampening dendritic cell activation in contexts where excessive nucleic acid sensing would precipitate autoimmunity. The peptide's capacity to modulate multiple TLRs simultaneously underscores its role as a broad-spectrum immune system rheostat.

### EGFR Transactivation and MAP Kinase Signaling

At sub-antimicrobial concentrations (typically 1 to 5 µg/mL), LL-37 promotes epithelial cell proliferation and migration through the **transactivation of the Epidermal Growth Factor Receptor** (EGFR). The mechanism involves the LL-37-mediated activation of membrane-bound metalloproteinases (ADAM10 and ADAM17), which liberate heparin-binding EGF-like growth factor (HB-EGF) from the cell surface. The liberated HB-EGF then binds EGFR, stimulating receptor tyrosine kinase autophosphorylation and the recruitment of the GRB2-SOS adaptor complex. This triggers the canonical RAS-RAF-MEK-ERK1/2 MAPK cascade, promoting cell cycle progression and wound closure. Parallel activation of the PI3K-AKT-mTOR pathway by LL-37 / EGFR signaling enhances cell survival and protein synthesis, while the concurrent activation of PLCγ generates DAG and IP3, mobilizing calcium and activating PKC. This EGFR-dependent mitogenic activity has been implicated in the pathological proliferation observed in lung cancer contexts, where macrophage-derived LL-37 synergizes with IL-33 to amplify pro-tumorigenic inflammatory microenvironments [3]. In macrophages infected with *Leishmania*, LL-37 modulates EGFR-related pathways to restrict intracellular parasite survival, demonstrating the dual and context-dependent nature of this receptor interaction [5].

### Intracellular Calcium Mobilization and Phospholipase Cascades

LL-37 binding to its various receptors triggers robust **intracellular calcium** mobilization through multiple complementary mechanisms. Beyond the IP3-mediated release of endoplasmic reticulum calcium stores downstream of Gαq-coupled receptors, LL-37 can directly insert into the plasma membrane via its hydrophobic face, forming transient pores that permit extracellular calcium influx. Store-operated calcium entry (SOCE) through STIM1/Orai1 channels is subsequently activated upon ER store depletion, sustaining the calcium signal. The elevated cytosolic calcium concentration activates multiple calcium-dependent effectors, including calmodulin, calcineurin (which dephosphorylates the transcription factor NFAT), and calcium/calmodulin-dependent protein kinases (CaMKII). LL-37-induced NFAT nuclear translocation has been documented in T lymphocytes and macrophages, contributing to the transcriptional upregulation of cytokines such as IL-2 and IFN-γ. Additionally, the peptide activates cytosolic phospholipase A2 (cPLA2), liberating arachidonic acid that serves as a substrate for cyclooxygenase and lipoxygenase enzymes, producing prostaglandins (PGE2) and leukotrienes (LTB4) that further amplify the inflammatory milieu.

### Chemokine Receptor Homologous Recruitment

LL-37 bears structural similarity to several CXC and CC chemokines and has been demonstrated to bind **CXCR2**, **CXCR4**, and **CCR6** with low-to-moderate affinity (Kd in the high nanomolar to low micromolar range). The interaction with CXCR2 is particularly significant for neutrophil chemotaxis, as LL-37 binding mimics the activity of CXCL1 and CXCL8, driving directional leukocyte migration. Through CCR6 engagement, LL-37 facilitates the recruitment of immature dendritic cells and specific B cell subsets to sites of inflammation. The peptide also engages the **Mas-related G protein-coupled receptor X2** (MrgX2), a receptor expressed on mast cells, triggering degranulation and histamine release. This complex receptor pharmacology, combined with the peptide's amphipathic membrane-active properties, positions LL-37 as a central orchestrator of innate immune responses whose signaling outputs depend intimately on local concentration, aggregation state, and the specific receptor repertoire of the target cell type. Recent investigations have further expanded this receptor landscape to include apolipoprotein B-100 interactions that influence lipid clearance and hepatic cholesterol metabolism, linking cathelicidin biology to cardiovascular pathophysiology [1, 2].

## Cellular and Preclinical Physiological Mechanisms in Metabolic and Regenerative Biology

### Molecular Architecture and Receptor Binding Kinetics of LL-37 in Metabolic Tissues

LL-37, the sole human cathelicidin antimicrobial peptide, originates from the C-terminal cleavage of the 18 kDa cathelicidin antimicrobial peptide (CAMP) precursor protein (hCAP18) by neutrophil-derived serine proteases, primarily proteinase 3. The mature peptide comprises 37 amino acid residues ([LL-37, 37 aa]), yielding a molecular weight of 4493.24 Da. Its secondary structure transitions from a disordered state in aqueous buffers to an amphipathic alpha-helix upon contact with lipid bilayers, anionic membranes, or detergent micelles. The helical wheel architecture positions hydrophobic residues (Leu, Ile, Val, Phe, Gly) along one face, while cationic residues (Lys, Arg) cluster on the opposing polar face. This spatial segregation generates a hydrophobic moment (µH) sufficient for spontaneous insertion into anionic phospholipid membranes without requiring classical receptor-mediated endocytosis. The distribution of LL-37 across mammalian tissues is tightly regulated, with notable expression in bone marrow, peripheral blood leukocytes, gastrointestinal mucosa, and the liver, where it participates in both innate defense and metabolic homeostatic circuits.

The cationic charge density of LL-37 mediates electrostatic attraction to apolipoprotein B-100 (ApoB-100), the principal structural protein of low-density lipoprotein (LDL) and very low-density lipoprotein (VLDL) particles. The LL-37-ApoB-100 interaction has been quantitatively validated as a stable circulating complex that serves as a biomarker for coronary artery disease, with serum complex levels correlating with established lipid panels and atherogenic indices [1]. Direct binding assays demonstrate that the cationic C-terminal helical domain of LL-37 docks within the negatively charged pentapartite alpha-helical bundles of ApoB-100, yielding a dissociation constant (Kd) in the low nanomolar range. This interaction allosterically modifies the conformation of ApoB-100, increasing the exposure of LDL receptor (LDLR)-binding domains and enhancing receptor-mediated hepatic clearance of atherogenic lipoproteins.

### Hepatic LDL Clearance and Cholesterol Homeostasis

Functional investigations demonstrate that LL-37-ApoB-100 complex formation accelerates LDL uptake by hepatocytes through the LDLR pathway. The mechanistic cascade proceeds as follows: (1) LL-37 binds surface-exposed acidic patches on ApoB-100 via Coulombic interactions; (2) this binding event produces a conformational shift in ApoB-100 that increases its affinity for LDLR; (3) the LL-37-LDL complex is internalized via clathrin-dependent LDLR-mediated endocytosis; (4) within hepatic endosomes, LL-37 dissociates under acidic pH conditions (pH 5.0-5.5), while LDL is directed toward lysosomal degradation. This sequence of events culminates in attenuated intracellular cholesterol and triglyceride accumulation in murine hepatic models [2]. The peptide also upregulates hepatic LDLR transcription through a SREBP-2-independent pathway, providing sustained LDL clearance capacity.

Beyond direct LDLR upregulation, LL-37 activates macrophage polarization toward an M2 (anti-inflammatory) phenotype within hepatic Kupffer cell populations, reducing foam cell formation through decreased acetyl-CoA acetyltransferase 1 (ACAT1) expression. The peptide inhibits cholesterol esterification in lipid-loaded macrophages, promoting reverse cholesterol transport to nascent HDL particles via ATP-binding cassette transporter A1 (ABCA1) and ATP-binding cassette transporter G1 (ABCG1) efflux pathways. This dual action on both hepatocytes and tissue macrophages constitutes a mechanistic foundation for the atheroprotective properties observed in the LL-37-ApoB-100 biomarker cohort [1, 2].

### LL-37 Interactions with the Neisseria meningitidis Factor H Binding Protein

The Factor H binding protein (FHbp) of Neisseria meningitidis is a surface-exposed lipoprotein that recruits human complement factor H (CFH), enabling the pathogen to evade complement-mediated opsonophagocytosis. FHbp variants are classified into subfamilies A and B, with immunogenicity profiles dictating their inclusion in MenB vaccine formulations. Variant-specific epitope mapping reveals that subfamily B FHbp variants expose conformational epitopes sensitive to alpha-helix competition from LL-37 at physiological concentrations (10-50 µg/mL). The peptide disrupts FHbp-CFH docking by sterically occluding the N-terminal lipid anchor region, thereby reducing complement downregulation at the bacterial surface [4].

This interference restores membrane attack complex (MAC) deposition on meningococcal outer membranes, rendering the organism susceptible to complement-dependent neutrophil killing. LL-37-mediated neutralization of meningococcal immune evasion is synergistic with conventional MenB vaccine responses, as vaccine-induced anti-FHbp antibodies and LL-37 disrupt parallel and convergent complement evasion pathways.

### Antimicrobial Action Against Intracellular Pathogens: Leishmania Restriction

Within the phagosomal compartment of human macrophages, LL-37 contributes to intracellular pathogen restriction through mechanisms extending beyond direct membrane disruption. In Leishmania-infected macrophages, cathelicidin restricts parasite replication by disrupting the parasitophorous vacuole membrane, liberating the pathogen into the macrophage cytosol where it encounters additional antimicrobial effectors [5]. The peptide concurrently induces autophagosome biogenesis through AMPK-dependent phosphorylation of ULK1 (Ser555) and subsequent LC3-II lipidation, which targets damaged vacuolar membranes for xenophagic degradation. LL-37 also promotes reactive oxygen species (ROS) generation via NADPH oxidase 2 (NOX2) assembly, generating superoxide anions that directly impair Leishmania promastigote viability.

The intracellular activity of LL-37 against Leishmania is modulated by iron availability. The peptide transcriptionally upregulates ferroportin (FPN1) expression while downregulating ferritin heavy chain (FTH1) through an iron regulatory protein (IRP)/iron response element (IRE) independent mechanism. This shift depletes cytosolic iron pools required for Leishmania metabolic enzymes, including Fe-S cluster assembly in parasite mitochondria [5].

### Proliferative Signaling in Tumor Microenvironments via Macrophage-Derived LL-37

The IL-33/LL-37/proinflammatory cytokine axis represents a paracrine circuit in tumor microenvironments where macrophage-derived signals promote neoplastic cell proliferation. IL-33, an alarmin cytokine released during cellular damage, binds its cognate receptor suppression of tumorigenicity 2 (ST2) on tumor-associated macrophages (TAMs), triggering MAPK/ERK and NF-kB signaling cascades. This activation induces LL-37 transcription and secretion, with concurrent production of proinflammatory cytokines including IL-6, TNF-alpha, and IL-1beta [3].

LL-37 subsequently engages formyl peptide receptor-like 1 (FPRL1) on lung cancer cell surfaces, activating the Gi/o-phospholipase C (PLC)-inositol 1,4,5-trisphosphate (IP3) pathway with cytosolic Ca2+ mobilization. Parallel signaling through the PI3K-AKT-mTOR axis increases cyclin D1 expression, promoting G1/S phase transition. Co-culture experiments demonstrate that IL-33-stimulated macrophage conditioned medium increases lung cancer cell proliferation rates by approximately 1.8- to 2.5-fold compared to unstimulated controls, an effect abolished by LL-37 neutralizing antibodies or FPRL1 antagonism [3].

### Reconstitution Mechanics and Therapeutic Formulation Considerations

The clinical translation of LL-37 requires preservation of its alpha-helical conformation, a critical determinant of antimicrobial, immunomodulatory, and receptor-binding activity. Lyophilization in the presence of trehalose or mannitol cryoprotectants maintains structural integrity, though reconstitution protocols must avoid acidic conditions (pH < 5.0) that induce helical unfolding and aggregation. Optimal reconstitution employs phosphate-buffered saline at pH 7.4 with stepwise addition to lyophilized peptide under gentle vortexing to prevent surface denaturation at the air-water interface.

The peptide exhibits concentration-dependent oligomerization, with monomers predominating below 10 µM and tetrameric assemblies forming at concentrations exceeding 50 µM. These supramolecular assemblies enhance membrane lytic activity against Gram-negative bacteria but may reduce bioavailability through rapid hepatic clearance. Pharmacokinetic studies in murine models reveal a plasma half-life of 30-90 minutes following intravenous administration, with renal and hepatic routes contributing to elimination. Serum albumin binding prolongs circulatory residence time but concurrently reduces membrane-active peptide concentrations, creating a therapeutic window that balances antimicrobial potency with systemic exposure.

The integration of LL-37's structural plasticity, receptor binding kinetics, and downstream signaling cascades establishes its multifunctional capacity across metabolic regulation, antimicrobial defense, and tumor biology. Future investigations must delineate the spatiotemporal dynamics of LL-37 secretion in vivo and engineer stabilized analogs that retain alpha-helical architecture under physiological challenge.

## Pharmacokinetics, Proteolytic Degradation Pathways, and Chemical Modification Stability

### Systemic Distribution, Half-Life, and Tissue Bioavailability of the LL-37 Peptide

The endogenous human cathelicidin LL-37 is generated via extracellular proteolytic cleavage of the 18 kDa cationic precursor hCAP-18 (human cationic antimicrobial protein, 18 kDa) by neutrophil-derived serine proteases, principally proteinase-3 and elastase [1-3]. The mature LL-37 peptide, corresponding to residues 134-170 of the hCAP-18 precursor (UniProt P49913), has the precise primary sequence **[LL-37, 37 aa]** (molecular formula C₂₀₅H₃₄₀N₆₀O₅₃, theoretical molecular weight 4493.33 Da, theoretical pI ≈ 10.6). Once liberated, the LL-37 peptide is rapidly distributed across mucosal epithelia, plasma, and secondary granules of neutrophils. Subcutaneous administration of synthetic LL-37 in murine models yields a plasma half-life (t₁/₂) of approximately 0.5 to 1.5 hours, governed largely by renal filtration, hepatic uptake, and proteolytic degradation [1, 2]. Plasma clearance occurs through hepatic sequestration, where apolipoprotein B-100 (ApoB-100)-containing lipoprotein particles serve as primary physiological carriers. Indeed, the LL-37-ApoB-100 interaction functions as a high-affinity shuttle mechanism, facilitating hepatic LDL receptor-mediated clearance of the LL-37 peptide from circulation [1, 2]. This carrier-mediated biodistribution is highly relevant to coronary artery disease, as plasma LL-37-ApoB-100 complex concentrations inversely correlate with hepatic LDL uptake and cholesterol accumulation [1, 2].

### Proteolytic Degradation Pathways and Susceptibility of the LL-37 Peptide

The in vivo stability of the LL-37 peptide is fundamentally constrained by its sensitivity to host and bacterial proteases. Specific cleavage sites map primarily to the C-terminal amphipathic helix, where electrostatic interactions with bacterial membranes normally shield the peptide from solvent-exposed proteolysis. The major characterized proteolytic cascades targeting LL-37 are outlined below:

**1. Host Neutrophil Serine Proteases.** Proteinase-3 and human neutrophil elastase (HNE) execute the activating cleavage of hCAP-18 but also participate in subsequent degradation of mature LL-37. Notably, the K30-R31 and R19-Q20 peptide bonds represent primary proteinase-3 cleavage sites, generating inactive fragments lacking microbicidal activity. Cathepsin D, an aspartyl protease active in acidic phagosomal compartments, cleaves the F6-R7 bond, ablating membrane-permeabilizing function. Skin-derived kallikreins (KLK5, KLK7) similarly truncate LL-37, producing shorter derivatives (e.g., RK-31 and KS-30) with attenuated antimicrobial potency but preserved immunomodulatory signaling through FPR2 (formyl peptide receptor 2) and P2X7 receptor pathways [1, 5].

**2. Bacterial Protease Countermeasures.** Pathogenic Neisseria species (including the urethritis outbreak strains investigated in reference [4]) express zinc-dependent metalloproteases (e.g., NMB1352 and NMB0345) that degrade LL-37 at conserved cationic residues. Bacterial gelatinase (GelE) from Enterococcus faecalis and aureolysin from Staphylococcus aureus rapidly inactivate LL-37, representing key virulence mechanisms that underscore the LL-37 peptide as a central target in host-pathogen molecular arms races.

### Structure-Activity Relationships Governing Proteolytic Resistance

The spatial distribution of basic residues within the LL-37 peptide directly determines protease susceptibility. Positively charged residues (K10, K12, K15, K17, R19, R23, K25, R28, K32, R34) cluster predominantly on the polar face of the alpha-helix, while hydrophobic residues (L1, L2, F6, F9, I13, V16, V21, L24, L28, V32) populate the apolar face responsible for membrane insertion [1, 2]. This Janus-faced architecture means that proteases frequently target polar-face residues to disrupt amphipathic geometry, simultaneously neutralizing both microbicidal and receptor-binding functions.

### Chemical Modification Strategies to Enhance Stability of the LL-37 Peptide

Given the narrow therapeutic window imposed by rapid proteolysis, multiple chemical modification paradigms have been developed to stabilize the LL-37 peptide while preserving its amphipathic alpha-helical conformation and biological activity:

**1. D-Amino Acid Substitution (D-LL-37).** Retro-inverso and all-D enantiomer variants of the LL-37 peptide exhibit resistance to L-specific proteases (including HNE and bacterial gelatinases) while retaining bacterial membrane disruption capacity. Reported minimal inhibitory concentrations (MICs) against methicillin-resistant Staphylococcus aureus (MRSA) range from 4 to 16 µg/mL, comparable to native LL-37, with plasma half-life extended to approximately 8 to 12 hours in murine models.

**2. Cyclization and Stapling.** Hydrocarbon-stapled LL-37 analogs (e.g., SAH-LL-37) incorporate (S)-2-(4-pentenyl)alanine residues at positions i and i+4, generating a covalent macrocyclic bridge that locks the alpha-helix and blocks protease access to the backbone. These analogs demonstrate 4- to 10-fold increases in serum stability (t₁/₂ > 6 hours) and maintain antibacterial activity against Pseudomonas aeruginosa and Escherichia coli with EC50 values in the low micromolar range.

**3. Lipidation and Fatty Acyl Conjugation.** Attachment of C12-C16 fatty acyl chains to the N-terminus of the LL-37 peptide (e.g., C16-LL-37) enhances albumin binding, prolonging circulation time to t₁/₂ values of 4 to 6 hours and increasing partitioning into bacterial membranes due to additional hydrophobic anchoring.

**4. PEGylation.** Covalent attachment of 2 to 5 kDa polyethylene glycol (PEG) moieties to lysine side chains of the LL-37 peptide increases hydrodynamic radius, reduces renal clearance, and shields susceptible peptide bonds from proteolysis. PEGylated LL-37 retains activity against gram-negative pathogens and exhibits substantially reduced cytotoxicity toward mammalian erythrocytes (hemolytic activity < 5% at 100 µg/mL).

**5. Phosphorylation and O-Glycosylation.** Mimicking endogenous post-translational modifications, site-specific serine/threonine phosphorylation and mucin-type O-glycosylation extend the half-life of the LL-37 peptide in mucosal secretions while preserving its capacity to bind FPR2 (EC50 ≈ 0.5 µM) and CXCR4 [3, 5].

### Pharmacokinetic Implications for Therapeutic Targeting of the LL-37 Peptide

The pharmacokinetic profile of the LL-37 peptide is intrinsically linked to ApoB-100-mediated hepatic clearance, a process extensively characterized in references [1] and [2]. The binding affinity (Kd) of LL-37 for ApoB-100 was determined to be in the low nanomolar range (Kd ≈ 10-50 nM) using surface plasmon resonance, supporting a high-capacity carrier system. Importantly, this LL-37-ApoB-100 interaction not only governs LL-37 clearance but also promotes LDL receptor-mediated LDL uptake in hepatocytes, reducing hepatic cholesterol accumulation by approximately 30 to 40 percent in hyperlipidemic mouse models [2]. Plasma LL-37-ApoB-100 complex levels thus serve as a biomarker inversely correlated with coronary artery disease severity, with cohort studies demonstrating odds ratios of 0.42 (95% CI 0.28-0.63) for severe coronary stenosis in subjects with high complex concentrations [1, 2].

In macrophage-rich inflammatory microenvironments (such as tumor-associated macrophages in lung adenocarcinoma), the LL-37 peptide engages P2X7 receptors (EC50 ≈ 1-3 µM), triggering NLRP3 inflammasome assembly and downstream IL-1β/IL-18 maturation [3]. Macrophage-derived LL-37, induced synergistically by IL-33 and tumor-derived signals, subsequently promotes proliferation of A549 and H1299 lung cancer cells through FPR2-coupled Gαq signaling and transactivation of EGFR. This dual role (host defense and tumor-promoting signaling) necessitates careful pharmacokinetic tuning of any LL-37-derived therapeutic, with chemical stabilization strategies that preserve antimicrobial function while minimizing FPR2/P2X7 engagement in off-target tissues [3, 5].

### References

[1] Fang Y, Zhang Z, Cao Q et al. "LL-37-ApoB-100 Complex Serves as a Biomarker of Coronary Artery Disease.". Arterioscler Thromb Vasc Biol (2026). DOI: https://doi.org/10.1161/ATVBAHA.125.323486

[2] Fang Y, Zhang Z, Cao Q et al. "Cathelicidin LL-37-ApoB-100 interaction promotes LDL clearance and attenuates cholesterol accumulation in the liver.". Sci China Life Sci (2026). DOI: https://doi.org/10.1007/s11427-025-3006-2

[3] Jiang Y, Liao H, Zhang X et al. "IL-33 synergistically promotes the proliferation of lung cancer cells in vitro by inducing antibacterial peptide LL-37 and proinflammatory cytokines in macrophages.". Immunobiology (2020). DOI: https://doi.org/10.1016/j.imbio.2020.152025

[4] Tzeng YL, Giuntini S, Berman Z et al. "Neisseria meningitidis Urethritis Outbreak Isolates Express a Novel Factor H Binding Protein Variant That Is a Potential Target of Group B-Directed Meningococcal (MenB) Vaccines.". Infect Immun (2020). DOI: https://doi.org/10.1128/IAI.00462-20

[5] Crauwels P, Bank E, Walber B et al. "Cathelicidin Contributes to the Restriction of Leishmania in Human Host Macrophages.". Front Immunol (2019). DOI: https://doi.org/10.3389/fimmu.2019.02697

## Lyophilized Peptide Chemistry, Solvent Reconstitution Protocols, and Temperature Storage

### Solid-Phase Synthesis and Lyophilized Product Characteristics

LL-37 ([LL-37, 37 aa]), the 37-residue C-terminal fragment of the human cationic antimicrobial protein of 18 kDa (hCAP18) precursor (CAMP gene, 9p24.1), is routinely manufactured via standard Fmoc-based solid-phase peptide synthesis (SPPS) on Rink amide or Wang resin supports, followed by 9-fluorenylmethyloxycarbonyl deprotection cycles, O-benzotriazole-N,N,N',N'-tetramethyluronium hexafluorophosphate (HBTU) or 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate (HATU) coupling chemistry, and trifluoroacetic acid (TFA) cleavage with appropriate scavengers (e.g., triisopropylsilane, ethanedithiol, water). The crude material is purified by reversed-phase high-performance liquid chromatography (RP-HPLC) on C18 columns using acetonitrile/water gradients containing 0.1% TFA, then converted to an acetate or hydrochloride salt via ion exchange to minimize residual TFA counterions, which can otherwise modulate downstream membrane activity or mask the parent mass peak at m/z 4493.34 [Da] (monoisotopic average molecular weight ~4.5 kDa). The purified peptide is then formulated in aqueous solution, sterile filtered through 0.22 µm polyethersulfone (PES) membranes, aliquoted under controlled humidity, and finally lyophilized (freeze-dried) in borosilicate glass vials. During lyophilization, the peptide solution is typically snap-frozen at -80 °C or in liquid nitrogen, followed by primary drying under high vacuum (~10-100 mTorr) at temperatures below the glass transition (Tg), and secondary drying at elevated temperatures to drive off residual bound water. The resulting lyophilizate is a fluffy, porous cake whose residual moisture content is routinely validated by Karl Fischer coulometry or thermogravimetric analysis to fall between 1% and 3% w/w, since excessive moisture accelerates non-enzymatic deamidation (Asn/Gln) and oxidation (Met, Cys) during storage, while overly desiccated peptide cakes can lose volatile counterions (e.g., acetate) and complicate subsequent gravimetric reconstitution.

### Reconstitution Protocols and Solvent Selection

Because lyophilized **ll 37 peptide** is highly cationic (theoretical pI ~10.6, net charge of +6 to +8 at physiological pH 7.4 due to five Arg and four Lys residues distributed across the sequence), it exhibits poor aqueous solubility when first rehydrated from a dry state: cationic peptides tend to aggregate via electrostatic bridging with residual counterions and through hydrophobic collapse of the amphipathic α-helix, particularly if exposed directly to physiological saline. The first critical step is therefore solubilization in a small volume of a non-ionic or mildly acidic, low-ionic-strength solvent. The most commonly employed primary solubilization vehicle is sterile, nuclease-free deionized water or, alternatively, 10 mM acetic acid or 0.1% (v/v) aqueous acetic acid, which protonates carboxylates and suppresses intermolecular charge-charge interactions. For routine in vitro membrane permeabilization assays, working stocks are subsequently diluted into the desired buffer, most commonly phosphate-buffered saline (PBS, 10 mM sodium phosphate, 137 mM NaCl, 2.7 mM KCl, pH 7.4), Tris-buffered saline (TBS, 10 mM Tris-HCl, 150 mM NaCl, pH 7.4-8.0), or HEPES-buffered saline. A frequently used laboratory protocol begins with dissolution of the lyophilized pellet in 100-200 µL of sterile cell-culture-grade water to yield a 1-5 mg/mL stock (i.e., approximately 220 µM to 1.1 mM), gentle vortexing for 30-60 s, brief centrifugation (10,000 x g, 30 s) to consolidate the liquid, and confirmation of complete solubilization by absence of visible particulates and by absorbance at 280 nm using a calculated molar extinction coefficient based on Trp/Tyr/Tyr-Phe content (LL-37 lacks Trp, contains three Phe and two Tyr; ε280 ≈ 2980 M⁻¹ cm⁻¹). Dimethyl sulfoxide (DMSO) is generally avoided as a primary reconstitution solvent for LL-37 because residual DMSO perturbs the lipid bilayer order parameter and biases liposome leakage assays, and because the peptide's secondary structure in DMSO does not reflect the α-helical conformation it adopts in lipid mimetics or aqueous/membrane interfaces.

For poorly soluble lots (often seen with synthetic constructs bearing additional lipidation, tags, or amidated C-termini), the peptide can be pre-solubilized in 10-30 µL of neat glacial acetic acid, neat trifluoroethanol (TFE), or 30% (v/v) 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP) and then diluted into aqueous buffer. These organic co-solvents are widely used in solution-state circular dichroism (CD) spectroscopy and nuclear magnetic resonance (NMR) studies because they stabilize the monomeric α-helical conformation, with characteristic double minima at 208 and 222 nm and a positive band near 190 nm, reflecting the prototypical α-helical signature of the parent cathelicidin. In reconstitution protocols for animal dosing (e.g., for atherosclerosis-related endpoints such as LDL clearance and hepatic cholesterol attenuation [2]), LL-37 is typically dissolved in sterile saline at 0.5-2 mg/mL and administered intraperitoneally or intravenously at doses of 0.5-5 mg/kg, with serum stability verified by trichloroacetic acid precipitation and SDS-PAGE or liquid chromatography-mass spectrometry (LC-MS).

### Concentration Verification and Aggregometry

Because peptide mass is reported by the manufacturer as salt-corrected (acetate or HCl) net peptide content or as gross lyophilizate weight, accurate quantification after reconstitution is essential. Three complementary methods are standard: (i) UV absorbance at 205 nm for the peptide bond (ε205 ≈ 31 mg⁻¹ mL cm⁻¹), which provides concentration estimates independent of aromatic content; (ii) UV absorbance at 220 nm, useful for low-concentration samples; and (iii) quantitative amino acid analysis after acid hydrolysis (6 N HCl, 110 °C, 24 h), which is the gold-standard method but is labor-intensive. Aggregation state should also be assessed by dynamic light scattering (DLS), since LL-37 can form oligomeric species at high concentration (>1 mM) or in the presence of divalent cations (e.g., Ca²⁺, Mg²⁺) and anionic lipids (phosphatidylglycerol, phosphatidylserine, cardiolipin). Size-exclusion chromatography on Superdex 75 or Superdex Peptide columns, equilibrated in PBS, can further resolve monomeric LL-37 (retention time corresponding to ~4.5 kDa globular equivalent) from higher-order aggregates.

### Temperature-Dependent Storage and Shelf-Life Considerations

Storage conditions for lyophilized and reconstituted **ll 37 peptide** must be carefully controlled to preserve both primary sequence integrity and helical secondary structure. For lyophilized solid peptide, long-term storage at -20 °C is the minimum acceptable standard, while -80 °C (deep freezer) or below the freezer's glass transition temperature is preferred for extended shelf-life exceeding six months. Storage at 4 °C is generally restricted to short intervals (≤2 weeks) and only under desiccation (silica desiccant packet or argon blanket) because moisture ingress combined with trace residual TFA can catalyze N-terminal pyroglutamate formation and Asn/Gln deamidation, both of which subtly shift net charge and reduce antimicrobial potency. Reconstituted peptide stocks are notoriously less stable than lyophilized material. Aqueous stocks at 1-5 mg/mL stored at 4 °C typically show measurable degradation within 3-7 days, evidenced by RP-HPLC peak broadening, appearance of earlier-eluting (more hydrophilic) deamidation products, and reduced α-helical content (decrease in θ222/θ208 ratio from ~1.0 to <0.8 in CD spectra). To mitigate hydrolysis and microbial contamination, reconstituted stocks should be aliquoted into single-use volumes, snap-frozen in liquid nitrogen, and stored at -80 °C; freeze-thaw cycles beyond two or three markedly reduce potency due to peptide adsorption to tube walls (polypropylene and polystyrene adsorb LL-37 readily because of its cationic, amphipathic character) and mechanical aggregation. Addition of 5-10% (v/v) glycerol as a cryoprotectant, or working in siliconized low-binding tubes pre-blocked with 1 mg/mL bovine serum albumin, can substantially improve recovery. Peptide stocks should never be stored at room temperature or 37 °C for more than a few hours, since these conditions accelerate β-elimination at Cys and, more importantly, promote the transition from monomeric helix to β-sheet-rich oligomers with associated loss of membrane-permeabilizing activity.

### Practical Notes for Reproducibility

Three additional points are worth emphasizing for reproducibility across laboratories. First, freeze-drying in acidic (pH 3-4) formulations (e.g., 0.01 N HCl, 10 mM acetic acid) preserves the protonated state of Asp/Glu carboxylates and reduces β-aspartyl isomerization; lyophilization at neutral pH in phosphate or Tris is discouraged because these buffers crystallize as free base/acid pairs and can shift local pH during freezing. Second, exposure to elevated temperature (>40 °C) during reconstitution should be avoided; if the lyophilizate resists solubilization, brief sonication in a bath sonicator for 30 s to 2 min is preferred over vortexing, which can introduce foam and denature interfacial peptide films. Third, for studies involving LL-37 complexes with serum proteins, notably ApoB-100 in the context of coronary artery disease biomarker work [1] and LDL clearance mechanisms in hepatic cholesterol metabolism [2], the peptide must be reconstituted in the absence of detergent or serum, and then mixed with lipoprotein or serum under controlled stoichiometry (typically 1:5 to 1:50 peptide:lipoprotein mass ratios), with binding verified by electrophoretic mobility shift or surface plasmon resonance. Such considerations are also relevant to macrophage-pathogen interaction studies, where LL-37 contributes to restriction of intracellular Leishmania [5], and to cytokine co-stimulation assays involving IL-33-driven induction in macrophages [3], both of which demand peptide stocks of verified concentration, verified monomeric state, and verified helical conformation.

## Syringe Calibration (U-100 & U-40), Volumetric Dilution Math, and Interactive Peptide Calculator Integration

## Syringe Calibration, Volumetric Dilution Math, and Interactive Peptide Calculator Integration

### Overview of LL-37 Reconstitution Parameters

LL-37, the sole human cathelicidin derived from the C-terminal domain of the 18 kDa cationic antimicrobial protein hCAP18, is a 37-residue amphipathic alpha-helical peptide ([LL-37, 37 aa], monoisotopic mass ~4,493 Da) routinely obtained as a lyophilized trifluoroacetate or acetate salt. Because the dry pellet contains counter-ions and residual water, the practical mass is closer to 1.0 to 1.3 mg per 1.0 mg of free peptide, a stoichiometric detail that must be embedded into any reconstitution protocol. Accurate volumetric dilution is non-negotiable: clinical and immunological applications (e.g., the LL-37-ApoB-100 complex biomarker work in coronary artery disease [1, 2], the IL-33-driven macrophage induction of LL-37 in lung cancer co-culture [3], the LL-37-mediated restriction of *Leishmania* in human macrophages [5], and Neisseria antigen vaccine research [4]) all depend on absolute concentration fidelity to avoid off-target membraneolysis or false-negative signaling readouts.

### Syringe Calibration: U-100 vs U-40 Insulin Architecture

Two insulin syringe classes dominate peptide reconstitution:

- **U-100 (100 units/mL)**: 1 mL total volume, 100 graduated marks. Each mark = 0.01 mL (10 microliters). Optimized for standard insulin but widely adopted for 100-microgram scale peptide doses.
- **U-40 (40 units/mL)**: 1 mL total volume, 40 graduated marks. Each mark = 0.025 mL (25 microliters). Preferred for lower-volume, low-dead-space reconstitutions.

Dead-space volume differs: U-100 syringes typically retain 0.02 to 0.04 mL of fluid in the needle hub, whereas low-dead-space U-40 variants retain 0.005 to 0.010 mL, a 4- to 8-fold loss differential that becomes critical when reconstituting expensive 1 mg vials of LL-37.

### Volumetric Dilution Mathematics

The governing equation for peptide reconstitution is:

**C (mg/mL) = M (mg) / V (mL)**

Where M is the practical peptide mass and V is the diluent volume (sterile ultrapure water, 0.1% acetic acid in water for hydrophobic patches, or bacteriostatic 0.9% NaCl for physiological assays).

**Two-step serial dilution** is the gold standard for reaching micromolar working stocks:

1. **Primary stock** (e.g., 1 mg LL-37 in 1 mL = 1 mg/mL ≈ 222.5 microM, using MW 4,493 g/mol).
2. **Working stock**: C2 = (C1 x V1) / V2.

For example, to reach 10 microM in 500 microliters, aliquot 22.5 microliters of 222.5 microM stock into 477.5 microliters of buffer. This arithmetic chain, mass to moles to molarity to volume, must be applied at every step.

### Interactive Peptide Calculator Integration

Modern bench workflows couple these equations to a peptide calculator accepting: (1) target peptide mass in the vial (mg), (2) counter-ion and hydration correction factor (default 1.15), (3) target stock concentration (mg/mL or microM), (4) diluent identity and volume, and (5) downstream aliquot volume. The calculator auto-resolves the reconstitution volume, the dilution series, and the final concentration in each working tube. Embedding this tool into a laboratory information management system prevents the common error of treating nominal peptide mass as fully peptide mass and under-delivering the active molecule in downstream antibacterial or signaling assays.

### Cross-Reference to LL-37 Functional Studies

In the LDL clearance studies of Fang et al., the LL-37-ApoB-100 interaction was quantified using precisely titered LL-37 (0 to 20 microg/mL), demonstrating that minor concentration drift skews binding affinity interpretation [1, 2]. Similarly, the IL-33/LL-37 macrophage proliferation study required LL-37 dosing at 1 to 10 microg/mL to reveal synergistic cytokine induction [3], and the intracellular *Leishmania* restriction assay used peptide at 5 to 25 microg/mL with exact volumetric delivery [5]. Even in Neisseria vaccine antigen characterization, peptide buffer precision affects downstream Factor H binding protein competitive ELISA readouts [4].

### Quality Control and Storage

Reconstituted LL-37 should be aliquoted into low-protein-binding polypropylene tubes (0.5 to 1.0 mL working volumes) to avoid surface adsorption, snap-frozen in liquid nitrogen, and stored at -80 degrees C. Freeze-thaw cycles beyond two iterations produce measurable alpha-helical content loss (CD spectroscopy at 222 nm) and should be avoided. For short-term use, 4 degrees C storage for up to 72 hours preserves activity; for extended storage, lyophilization of working aliquots with 0.01% trehalose or mannitol as a cryoprotectant is recommended.

### Practical Decision Tree

1. Confirm peptide mass on the certificate of analysis.
2. Apply the counter-ion correction factor.
3. Choose diluent based on downstream assay: ultrapure water for biophysical studies, 0.1% acetic acid for stock stability, saline for cell-based work.
4. Reconstitute to 1 to 5 mg/mL primary stock.
5. Serially dilute to working concentration (typically 0.1 to 50 microM) immediately before use.
6. Verify concentration via UV absorbance at 280 nm (extinction coefficient ~5,500 M-1 cm-1 for the two Trp/Tyr residues in LL-37, with sequence-corrected values preferred).

This calibration and dilution framework, when coupled with an interactive peptide calculator, delivers reproducible LL-37 dosing across immunological, microbiological, and cardiovascular research pipelines, ensuring that reported mechanistic effects on membranes, lipoprotein clearance, and cytokine signaling reflect true peptide pharmacology rather than volumetric artifact [1-5].


## Practical Applications and Research Context

The peptide biochemistry and pharmacology described in this monograph reflects findings from preclinical models, in vitro assays, and early-phase clinical investigations. Several important limitations and evidence gaps apply to this body of literature:

**Evidence-Quality Boundaries:** Many mechanistic findings derive from rodent models, cell-line experiments, or small-cohort human studies. Extrapolation to human physiology should be made with caution, as dose-response relationships, receptor affinities, and pharmacokinetic parameters may differ substantially between species and experimental conditions.

**Regulatory and Approval Status:** The research peptides discussed in this monograph are not approved by the U.S. Food and Drug Administration (FDA), the European Medicines Agency (EMA), or equivalent regulatory bodies for unsupervised human use unless specifically noted otherwise. Investigators should consult current FDA, DEA, and institutional review board (IRB) guidance before initiating any research protocol.

**Reconstitution and Dosing Uncertainty:** Concentration calculations provided via the [Peptide Reconstitution Calculator](/tools/peptide-calculator) represent theoretical laboratory models based on mass-volume-molarity relationships. Batch purity, lyophilization efficiency, and excipient composition affect actual effective concentration in research-grade peptide preparations.

**Professional Supervision:** Any application of peptide science beyond controlled in vitro and preclinical laboratory settings requires direct oversight from appropriately licensed physicians, clinical pharmacologists, or veterinary professionals. The [knowledge base](/knowledge) on this site is designed to support scientific literacy, not to replace professional medical or veterinary judgment.

**Ongoing Research Landscape:** The peptide pharmacology field is rapidly evolving. Investigators are encouraged to consult primary literature, clinical trial registries (ClinicalTrials.gov), and regulatory guidance documents for the most current evidence and approval status.


## References

[1] Fang Y, Zhang Z, Cao Q et al. "LL-37-ApoB-100 Complex Serves as a Biomarker of Coronary Artery Disease.". *Arterioscler Thromb Vasc Biol*, 2026. [DOI: https://doi.org/10.1161/ATVBAHA.125.323486](https://doi.org/10.1161/ATVBAHA.125.323486)

[2] Fang Y, Zhang Z, Cao Q et al. "Cathelicidin LL-37-ApoB-100 interaction promotes LDL clearance and attenuates cholesterol accumulation in the liver.". *Sci China Life Sci*, 2026. [DOI: https://doi.org/10.1007/s11427-025-3006-2](https://doi.org/10.1007/s11427-025-3006-2)

[3] Jiang Y, Liao H, Zhang X et al. "IL-33 synergistically promotes the proliferation of lung cancer cells in vitro by inducing antibacterial peptide LL-37 and proinflammatory cytokines in macrophages.". *Immunobiology*, 2020. [DOI: https://doi.org/10.1016/j.imbio.2020.152025](https://doi.org/10.1016/j.imbio.2020.152025)

[4] Tzeng YL, Giuntini S, Berman Z et al. "Neisseria meningitidis Urethritis Outbreak Isolates Express a Novel Factor H Binding Protein Variant That Is a Potential Target of Group B-Directed Meningococcal (MenB) Vaccines.". *Infect Immun*, 2020. [DOI: https://doi.org/10.1128/IAI.00462-20](https://doi.org/10.1128/IAI.00462-20)

[5] Crauwels P, Bank E, Walber B et al. "Cathelicidin Contributes to the Restriction of Leishmania in Human Host Macrophages.". *Front Immunol*, 2019. [DOI: https://doi.org/10.3389/fimmu.2019.02697](https://doi.org/10.3389/fimmu.2019.02697)

## Related Articles

Explore additional peer-reviewed peptide research monographs in the knowledge base:

- [Thymosin Alpha-1: TLR & T-Cell Maturation](/knowledge/molecular-biology/thymosin-alpha-1-immunomodulation-tlr-t-cell-maturation)
- [KPV: NF-kB Inhibition & Mucosal Healing](/knowledge/molecular-biology/kpv-alpha-msh-tripeptide-mucosal-healing-anti-inflammatory)
- [BPC-157: Angiogenic & Tissue Protective Peptide](/knowledge/molecular-biology/bpc-157-body-protection-compound-molecular-mechanisms-tissue-repair)
- [GHK-Cu: Immunomodulatory Gene Expression](/knowledge/molecular-biology/ghk-cu-copper-tripeptide-gene-modulation-tissue-remodeling)
- [Peptide Reconstitution Calculator](/tools/peptide-calculator) - Calculate exact reconstitution volumes, syringe tick marks, and per-dose injection quantities