# CJC-1295 and Ipamorelin: GHRH Analogs and Ghrelin Mimetic Pharmacology, Pituitary Pulsatility, and Peptide Reconstitution Dynamics

## Key Takeaways

- **CJC-1295 GHRHR Signal Bias and DAC Pharmacokinetics:** Synthetic GHRH(1-29) analog with Lys³⁰ substitution binds class B1 Gα_s-coupled GHRHR (K_d ≈ 0.1-1 nM, EC₅₀ ≈ 1-10 nM), activating Gα_s/cAMP/PKA and L-type Ca²⁺ channel-mediated GH exocytosis; DAC bioconjugation extends plasma half-life from ~6-8 min to ~8 days via albumin tethering, producing sustained non-pulsatile GHRHR activation that disrupts native ultradian GH rhythm.
- **Ipamorelin GHS-R1a Selectivity Profile:** Pentapeptide ghrelin mimetic (MW ≈ 711 Da) acts as a selective Gα_q/11-coupled GHS-R1a agonist (EC₅₀ ≈ 1-10 nM) with negligible activity at GHRHR, SSTRs, MC receptors, or CD36, preserving PLCβ/IP₃/intracellular Ca²⁺ release while avoiding cortisol, prolactin, and vasopressin co-secretion common to less selective secretagogues.
- **Synergistic Somatotroph Co-activation Restoring Pulsatility:** Combined GHRHR and GHS-R1a agonism synergizes somatotroph output because GHS-R1a-driven Ca²⁺ mobilization amplifies GHRHR cAMP/PKA signaling, recapitulating the native ~60-180 min ultradian GH pulse contour lost with recombinant GH or chronic tonic GHRH exposure.
- **JAK2/STAT5 Signal Decoding and Somatostatin Counter-regulation:** Hepatic GHR dimerization activates JAK2/STAT5 phosphorylation driving IGF-1 transcription, while Gα_i-coupled SSTR2/SSTR5 suppress adenylate cyclase and activate GIRK channels, with rhythmic hypothalamic GHRH and somatostatin release sculpting the GH pulse contour that therapeutic analog strategies must preserve.
- **Volumetric Reconstitution Dynamics:** Concentration (mg/mL) equals peptide mass (mg) divided by diluent volume (mL), with molar conversions using MW values (CJC-1295 ≈ 3,367 Da without DAC; Ipamorelin ≈ 711 Da); standard protocols reconstitute 2 mg vials in 2 mL bacteriostatic water for 1,000 μg/mL, with proportional scaling (e.g., 5 mg Ipamorelin in 3 mL yields ≈ 1,667 μg/mL, delivering 50 μg per 30 μL aliquot).

> **Academic Research & Educational Disclaimer:** This scientific monograph is published exclusively for academic research, molecular biology education, laboratory investigation, and informational reference. Unapproved synthetic peptides discussed herein are intended strictly for in vitro and controlled preclinical laboratory research by qualified scientific investigators and are not intended for human consumption, direct medical self-administration, diagnostic application, or therapeutic use without direct medical supervision and valid clinical authorization. All concentration and volumetric calculations derived from the [Peptide Reconstitution Calculator](/tools/peptide-calculator) represent theoretical laboratory mathematical models based on molarity, vial mass, and diluent volume, and do not constitute clinical prescribing advice or human dosing recommendations.

## The Hypothalamic-Pituitary-Somatotropic Axis: Pulsatile Growth Hormone Release Biology

### Architectural Overview of the Somatotropic Axis

The hypothalamic-pituitary-somatotropic (HPS) axis is a hierarchically organized neuroendocrine circuit that governs somatic growth, substrate metabolism, and tissue regeneration through the orchestrated secretion of growth hormone (GH) from anterior pituitary somatotrophs [1, 4]. The system is regulated by a tri-peptidergic hypothalamic input composed of growth hormone-releasing hormone (GHRH), somatostatin (SS, also termed somatotropin release-inhibiting factor, SRIF, or GHIH), and the stomach-derived orexigenic peptide ghrelin, which collectively determine the amplitude, frequency, and contour of pituitary GH pulses [1, 2, 4]. A defining feature of this axis is that downstream biological efficacy is achieved not by tonic GH exposure but by a highly specific pattern of pulsatile secretion that is decoded by the GH receptor (GHR) and the downstream Janus kinase 2 / signal transducer and activator of transcription 5 (JAK2/STAT5) signaling cascade in hepatic and extrahepatic tissues [1, 4, 6].

### Hypothalamic Releasing and Inhibiting Factors

**Growth Hormone-Releasing Hormone (GHRH)** is a 44-amino acid C-terminally amidated peptide (molecular weight ≈ 5,040 Da) derived from the preprohormone encoded by the *GHRH* gene on chromosome 20p12. The bioactive sequence corresponds approximately to GHRH(1-44)-NH₂, with the N-terminal 29 residues conferring full intrinsic biological activity at the GHRH receptor (GHRHR), a class B1 G protein-coupled receptor (GPCR) expressed predominantly on somatotroph cell membranes [1, 2, 4]. Binding of GHRH to GHRHR (reported binding affinity K_d ≈ 0.1-1 nM in radioligand displacement assays) activates the Gα_s/cAMP/PKA pathway, elevates intracellular cAMP (with EC₅₀ ≈ 1-10 nM), and triggers L-type voltage-gated Ca²⁺ channel-mediated Ca²⁺ influx, driving exocytosis of preformed GH granules [2, 4]. Parallel activation of PLCβ → IP₃ → Ca²⁺ release from endoplasmic reticulum stores contributes to the somatotroph's secretory response.

**Somatostatin (SRIF)** is produced in two principal bioactive isoforms: somatostatin-14 (SS-14, 14 aa, MW ≈ 1,638 Da) and somatostatin-28 (SS-28, 28 aa, MW ≈ 3,149 Da), both derived from the *SST* gene and acting at somatostatin receptors 1-5 (SSTR1-5), of which SSTR2 and SSTR5 predominate on somatotrophs [1, 2, 4]. SSTR2/5 are Gα_i-coupled GPCRs whose activation suppresses adenylate cyclase, diminishes cAMP, hyperpolarizes the cell via G-protein-coupled inwardly rectifying potassium (GIRK) channels, and reduces voltage-gated Ca²⁺ entry, thereby inhibiting GH release [1, 4]. The interplay between rhythmic GHRH release (every ~60-180 min in adult humans) and reciprocal SS troughs generates the characteristic ultradian GH pulsatility [1, 2, 7].

**Ghrelin and the GHS-R1a Receptor.** Ghrelin is a 28-amino acid acylated peptide (MW ≈ 3,371 Da) secreted primarily by X/A-like enteroendocrine cells of the oxyntic gastric mucosa [1, 2]. Serine-3 octanoylation (n-octanoyl modification by ghrelin-O-acyltransferase, GOAT) is obligatory for binding to the growth hormone secretagogue receptor 1a (GHS-R1a), a class A GPCR (K_i for acyl-ghrelin ≈ 1-10 nM) [2, 4]. GHS-R1a couples primarily to Gα_q/₁₁, activating PLCβ → IP₃/DAG → PKC → Ca²⁺ mobilization, with secondary Gα_q-independent β-arrestin recruitment producing sustained ERK1/2 phosphorylation [2, 4]. The integration of GHS-R1a and GHRHR signaling is fundamental to the pharmacology of synthetic ghrelin mimetics such as ipamorelin and hexarelin and underlies their use as synergistic partners to GHRH analogs in combined secretagogue regimens [5].

### Mathematical and Temporal Features of Pulsatile GH Release

Pulsatile GH secretion in healthy adult males is characterized by 6-10 secretory bursts per 24-hour period, with the largest amplitude pulse typically occurring shortly after sleep onset in association with slow-wave (stage III/IV) sleep [1, 4, 7]. Quantitative deconvolution analysis reveals that approximately 70-80% of total daily GH secretion occurs within the ascending and descending limbs of discrete pulses, with interpulse nadir concentrations approximating 0.03-0.1 µg/L and peak concentrations ranging 5-40 µg/L depending on age, sex, body composition, and nutritional status [4, 7]. Fasting, hypoglycemia, exercise, and amino acid loading (notably L-arginine and L-lysine at supraphysiologic doses) amplify pulse amplitude, whereas hyperglycemia, elevated free fatty acids, obesity, and aging suppress it [1, 4, 7].

The pulsatile signal is decoded by the GHR, a type I cytokine receptor (MW ≈ 130 kDa, 638 aa in its mature form), which dimerizes upon GH binding (1:2 stoichiometry, K_d ≈ 0.2-1 nM) and activates JAK2 → STAT5b phosphorylation [1, 4, 6]. Critically, supraphysiologic continuous GH exposure produces receptor downregulation, sustained suppressor of cytokine signaling (SOCS) proteins 1 and 3 expression, and attenuation of STAT5b-mediated transcription of *IGF1* and acid-labile subunit (*ALS*) genes in hepatocytes [1, 4, 6]. This mechanistic observation is the principal rationale for the clinical preference of pulsatile secretagogue stimulation over continuous GH infusion.

### Downstream Metabolic and Anabolic Effects of Pulsatile GH

Pulsatile GH signaling maintains hepatic production of insulin-like growth factor 1 (IGF-1, MW ≈ 7,649 Da, 70 aa single-chain polypeptide), which circulates at concentrations of 100-300 µg/L in adults, predominantly bound to IGF binding protein 3 (IGFBP-3) and ALS in a 150 kDa ternary complex [1, 4, 6]. IGF-1 activates the type 1 IGF receptor (IGF-1R, K_d ≈ 0.1-1 nM), a receptor tyrosine kinase that signals through IRS-1/PI3K/Akt/mTOR and Ras/Raf/MEK/ERK cascades to promote protein synthesis, chondrocyte proliferation, osteoblastic activity, and myocyte hypertrophy [6]. Within the skeleton, GH and IGF-1 act both systemically and locally to stimulate osteoblast differentiation, enhance periosteal bone formation, and inhibit osteoclastogenesis through modulation of RANKL/OPG balance [6].

Pulsatile GH exposure enhances lipolysis in visceral and subcutaneous adipose depots by activating hormone-sensitive lipase (HSL) and adipose triglyceride lipase (ATGL) through a cAMP/PKA/PPAR-γ-dependent mechanism, while simultaneously promoting amino acid uptake and nitrogen retention in skeletal muscle [1, 4]. Importantly, because each GH pulse is followed by a refractory period of somatostatin-mediated inhibition, the chronic activation of GH-dependent anti-insulin signaling (which would otherwise promote hepatic gluconeogenesis and reduce insulin sensitivity) is limited to discrete intervals, preserving overall glucose homeostasis [1, 4]. Continuous, non-pulsatile GH elevation, in contrast, has been shown to induce sustained insulin resistance, sodium-water retention, and soft-tissue edema - observations that historically limited the tolerability of exogenous recombinant GH therapy [1, 4, 8].

### Feedback Loops and Neuroendocrine Integration

The HPS axis is closed by both long-loop negative feedback (GH/IGF-1 acting on the hypothalamus and pituitary) and short-loop autofeedback (GH acting on hypothalamic GHRH and SS neurons) [1, 3, 4]. Wasinski et al. demonstrated that tyrosine hydroxylase-expressing neurons in the hypothalamic arcuate and periventricular nuclei are direct targets of GH feedback, providing a dopaminergic-mediated short-loop inhibitory circuit that fine-tunes somatotroph output [3]. IGF-1, in turn, suppresses GHRH transcription, stimulates SS release, and directly inhibits pituitary GH secretion, while ghrelin secretion is suppressed by elevated GH and IGF-1, completing the regulatory triad [1, 2, 4]. Recent work also implicates neuropeptide Y (NPY), orexin, galanin, and cortistatin as auxiliary modulators of GHRH/SS neuron activity, particularly under stress, fasting, and circadian challenge conditions [1, 2].

### Translational Significance for Secretagogue Therapeutics

The pulsatility-preserving pharmacology of GHRH analogs (e.g., CJC-1295, sermorelin, tesamorelin) and ghrelin mimetics (e.g., ipamorelin, hexarelin, GHRP-2, GHRP-6) is precisely what distinguishes them from continuous GH administration [5]. CJC-1295, depending on whether it includes (DAC) or lacks (no DAC) the 30-residue maleimide-based drug affinity complex, exhibits markedly different plasma half-lives - DAC variants demonstrate t₁/₂ ≈ 6-8 days in humans owing to covalent albumin binding, while the no-DAC form has a t₁/₂ of ≈ 30 minutes [5]. Ipamorelin, a pentapeptide ghrelin mimetic (Aib-His-D-2-Nal-D-Phe-Lys-NH₂; MW ≈ 711 Da), exhibits high selectivity for GHS-R1a (K_i ≈ 1-3 nM) with negligible effects on ACTH, cortisol, or prolactin release, and its synergy with CJC-1295 in amplifying the amplitude of endogenous GH pulses has become a focal point of performance-enhancing peptide research and clinical investigation alike [5]. For laboratory researchers preparing these peptides for in vitro or in vivo work, careful attention to vial content, diluent volume, and target concentration is essential - the interactive Peptide Reconstitution Calculator under /tools/peptide-calculator provides validated support for these determinations. The clinical implication, supported across multiple cited sources, is that combined GHRH analog plus ghrelin mimetic administration, by amplifying physiologic pulsatile GH output rather than replacing it, may more faithfully recapitulate the native endocrine signal than does exogenous GH itself, while still increasing integrated 24-hour IGF-1 production [1, 4, 5, 8].

## CJC-1295 Chemistry: Tetrasubstituted GHRH(1-29) and Drug Affinity Complex (DAC) Albumin Bioconjugation

### Molecular Architecture and Tetrapeptide Substitution Strategy

CJC-1295, also historically designated as Modified GRF (1-29) or tetrasubstituted GHRH, is a synthetic 30-amino-acid polypeptide engineering derivative of the native growth hormone-releasing hormone (GHRH) sequence (GHRH(1-29)-NH₂). Its molecular architecture is deliberately engineered to overcome two principal pharmacokinetic liabilities of endogenous GHRH: (1) rapid proteolytic degradation by dipeptidyl peptidase-4 (DPP-4) and endogenous endopeptidases, and (2) ultra-short circulatory residence time driven by renal filtration of the low-molecular-weight peptide (~3.4 kDa for unmodified GHRH(1-29)) [9]. CJC-1295 resolves these limitations through a rational strategy of site-directed amino acid substitution coupled, in one of its clinical formulations, to a covalent albumin-binding bioconjugation chemistry that exploits the lone free thiol of human serum albumin (HSA) at position Cys34 [9].

The peptide core consists of 29 residues homologous to the bioactive N-terminal fragment of human GHRH, terminating in a C-terminal amide (-CONH₂) to mimic the natural GHRH(1-29)-NH₂. Four discrete substitutions have been introduced at positions 2, 8, 15, and 27, each selected to enhance enzymatic stability and preserve or enhance binding affinity for the GHRH receptor (GHRHR), a class B1 G-protein-coupled receptor (GPCR) coupled predominantly to Gαs, adenylate cyclase, and the cyclic adenosine monophosphate (cAMP)/protein kinase A (PKA) axis [9].

### The Four Tetrasubstitutions: Biochemical Rationale

**Substitution 1: D-Ala² (Position 2).** Endogenous GHRH contains L-Ala at position 2, which renders the dipeptide bond between Ser¹ and Ala² a high-affinity substrate for DPP-4. DPP-4, a serine exopeptidase (EC 3.4.14.5), cleaves Xaa-Pro or Xaa-Ala dipeptides from the N-terminus, rapidly truncating native GHRH(1-29) to the inactive GHRH(3-29) fragment. Substituting the L-stereoisomer with **D-Ala** at position 2 introduces a non-natural stereocenter that is sterically incompatible with the DPP-4 S1 catalytic pocket, virtually abolishing N-terminal dipeptide cleavage. The D-configuration also confers generalized resistance to other aminopeptidases without compromising the ability of the adjacent Tyr¹ and Asp³ residues to engage the GHRHR extracellular domain.

**Substitution 2: Gln⁸ (Position 8).** The native sequence harbors a Ser at position 8. The hydroxyl side chain of Ser⁸ is susceptible to endopeptidase recognition and to potential hydrogen-bond-donating nucleophiles in circulating peptidases. Replacement with **glutamine (Gln)**, a side-chain amide isostere, removes the nucleophilic hydroxyl while preserving hydrogen-bonding capacity and overall topology. This enhances stability against neutral endopeptidase (NEP, neprilysin; EC 3.4.24.11) activity without sterically perturbing the alpha-helical fold required for receptor activation.

**Substitution 3: Ala¹⁵ (Position 15).** Endogenous GHRH contains Gly at position 15 within the amphipathic alpha-helix spanning residues ~6-20. Gly, lacking a side chain, confers local conformational flexibility that, while tolerable, exposes the backbone amide to endopeptidase access. Substitution with **alanine (Ala)** at this position introduces a small methyl side chain that (a) reduces local backbone entropy, stabilizing the active helical conformation, and (b) sterically shields the peptide backbone from endopeptidase docking, prolonging plasma survival.

**Substitution 4: Leu²⁷ (Position 27).** The C-terminal region of GHRH(1-29) is particularly vulnerable to cleavage by endopeptidases targeting hydrophobic motifs. The native Ser at position 27 is replaced with **leucine (Leu)**, a branched hydrophobic residue that (a) masks endopeptidase cleavage sites and (b) contributes to the hydrophobic face of the C-terminal alpha-helix, reinforcing GHRHR transmembrane-domain engagement. Collectively, these four substitutions (D-Ala², Gln⁸, Ala¹⁵, Leu²⁷) increase the plasma half-life of the analog from approximately 5-7 minutes (native GHRH(1-29)) to roughly **30 minutes** for the "DAC-less" preparation, while preserving receptor potency and downstream cAMP signaling.

### CJC-1295 Without DAC: Preserving Physiological Pulsatility

In its unconjugated form ("CJC-1295 No DAC"), the tetrasubstituted peptide is administered subcutaneously at typical research doses of 100-300 μg per injection, usually in twice-daily (BID) regimens or via pulsatile pump delivery to mimic the natural ultradian rhythm of endogenous GHRH secretion, which occurs in 3- to 5-hour pulses synchronized with slow-wave sleep. The ~30-minute elimination half-life ($t_{1/2} \approx 0.5$ h) of the unconjugated analog is clinically sufficient to support each secretory pulse but is too brief to produce sustained supraphysiologic GH exposure, an important safety property that reduces the theoretical risks of pituitary hyperplasia, hyperglycemia, and IGF-1-driven tissue overgrowth.

From a pharmacodynamic standpoint, CJC-1295 No DAC binds the GHRHR with high affinity ($K_d$ in the low nanomolar range), triggering Gαs-mediated activation of adenylate cyclase, elevation of intracellular cAMP, and PKA-catalyzed phosphorylation of transcription factors that drive somatotroph GH exocytosis. The downstream cascade also includes phospholipase C (PLC) recruitment, inositol-1,4,5-trisphosphate (IP₃)-mediated intracellular Ca²⁺ mobilization, and MAPK/ERK pathway activation, the latter contributing to somatotroph proliferation and IGF-1 synthesis at the hepatic level.

### CJC-1295 With DAC: Maleimidopropionic Acid Linker and Cys34 Albumin Conjugation

The "Drug Affinity Complex" (DAC) formulation introduces a chemical handle that fundamentally alters the pharmacokinetic profile of CJC-1295. The conjugation strategy relies on a **maleimidopropionic acid (MPA) linker** appended to the lysine ε-amine of the C-terminal residue (typically Lys³⁰ in some preparations, or a position-engineered Lys), with the free ε-amino group of the lysine side chain serving as the nucleophilic attachment point. The maleimide moiety of MPA is an excellent Michael acceptor that reacts chemoselectively with thiol nucleophiles at physiological pH (6.5-7.5), forming a stable, non-reversible thioether bond.

The biological target of this Michael addition is **Cys34 of human serum albumin (HSA)**, the single free cysteine residue in HSA (out of 35 total cysteine residues; 34 are engaged in 17 stabilizing disulfide bridges). Cys34 is located in subdomain IA of HSA and is accessible in circulating plasma at concentrations of approximately 600 μM (HSA plasma concentration ~40 g/L, M_r ≈ 66,500 Da). The chemical reaction is essentially quantitative in vivo when the conjugate is administered subcutaneously, since local thiol exchange with reduced glutathione is minimal at physiologic GSH (~2-10 μM in plasma) and the maleimide-thiol reaction rate (k ≈ 10³ M⁻¹s⁻¹) is rapid.

The resulting **CJC-1295-HSA bioconjugate** is a macromolecular complex with effective molecular weight in excess of 70 kDa, far above the glomerular filtration threshold (~60 kDa for the slit diaphragm), which means renal clearance is essentially eliminated. Instead, the conjugate is metabolized primarily via the HSA catabolic pathway, with an **elimination half-life of 6-8 days** ($t_{1/2} \approx 144-192$ hours). This dramatically extends the duration of GHRHR activation and produces a sustained, non-pulsatile elevation of GH and IGF-1 when administered weekly at typical research doses of 1-2 mg subcutaneously.

### Pharmacokinetic and Pharmacodynamic Comparison

| Parameter | CJC-1295 No DAC | CJC-1295 + DAC |
|---|---|---|
| **Half-life ($t_{1/2}$)** | ~30 minutes | 6-8 days |
| **Pulsatility** | Preserved (physiologic) | Blunted (sustained exposure) |
| **Clearance mechanism** | Renal + proteolytic | HSA catabolic + reticuloendothelial |
| **Receptor binding ($K_i$)** | Low nM at GHRHR | Low nM at GHRHR (unconjugated moiety) |
| **Dosing frequency** | BID or pulsed | Weekly |
| **IGF-1 elevation** | Pulsatile, modest | Sustained, supraphysiologic |

### Practical Reconstitution Considerations

For laboratory and research use, CJC-1295 (whether DAC or non-DAC) is supplied as a lyophilized acetate salt in 2-mg or 5-mg vials. Reconstitution typically employs **bacteriostatic water (BAC)**, with 0.9% benzyl alcohol as a preservative, or sterile water for single-use applications. A common protocol adds 2 mL of diluent to a 2-mg vial to yield a 1 mg/mL stock, from which 100-μL aliquots deliver 100-μg research doses.

Because dosing precision is critical - especially given the narrow therapeutic window between pulsatile GHRH replacement and supraphysiologic GH excess - researchers should employ the **Peptide Reconstitution Calculator** at `/tools/peptide-calculator`. This tool permits precise molarity calculations (peptide mass, moles, target concentration in μM or mg/mL) and accounts for the fact that CJC-1295's molecular weight is approximately 3,365-3,400 Da (without DAC linker; +158 Da for maleimidopropionic acid). For accurate laboratory calculations involving the DAC conjugate, the peptide-linker combined mass must be entered into the calculator prior to dilution planning.

The maleimide-Cys34 thioether bond is stable in aqueous formulations at 2-8 °C for up to 14-30 days, but freeze-thaw cycles should be strictly avoided to prevent albumin denaturation and thiol-disulfide exchange that could cleave the conjugate. Reconstituted aliquots should be stored in siliconized low-protein-binding vials to minimize adsorption of the hydrophobic peptide to container surfaces.

### Comparative Pharmacology With Sermorelin and Other GHRH Analogs

Compared with **sermorelin** (GHRH(1-29)-NH₂), the first-generation GHRH analog approved clinically, CJC-1295's tetrasubstitutions confer an order-of-magnitude improvement in plasma stability (sermorelin $t_{1/2} \approx 10-12$ min vs. CJC-1295 ~30 min). When combined with the DAC platform, CJC-1295 achieves a pharmacokinetic profile unattainable by sermorelin, effectively transforming a pulsatile secretagogue into a long-acting depot. This dual-form flexibility - pulsatile or sustained - is a defining pharmacologic advantage of the CJC-1295 platform and underlies its combinatorial use with ghrelin mimetics such as ipamorelin, which acts through the GHS-R1a receptor to amplify GH pulse amplitude, an interaction explored in the following sections.

---

*References are integrated from the local evidence base and are not reproduced here as a separate list, in accordance with section formatting conventions.*

## Ipamorelin Selective Ghrelin Receptor (GHS-R1a) Activation: Calcium Influx Without Cortisol/Prolactin Spikes

### Molecular Architecture and Receptor Binding Kinetics

Ipamorelin (INN; developmental codes NNC 26-0161 and NN703) is a synthetic pentapeptide whose primary sequence - Aib-His-D-2-Nal-D-Phe-Lys-NH₂ - incorporates several non-proteinogenic residues that collectively confer resistance to endopeptidase cleavage, intestinal proteolysis, and rapid hepatic first-pass metabolism [12, 13]. The α-aminoisobutyric acid (Aib) residue at the N-terminus introduces a sterically constrained α,α-disubstituted backbone that reduces the rotational freedom around the Cα-N bond, while the C-terminal lysine is amidated to neutralize the carboxyl terminus and enhance receptor affinity. The central D-2-Nal (D-3-(2-naphthyl)alanine) provides a hydrophobic aromatic surface that is essential for docking into the orthosteric transmembrane cavity of the class A G-protein-coupled receptor GHS-R1a (GHSR, UniProt Q92847) [12, 13]. The pharmacophore has a calculated monoisotopic mass of 711.39 Da and a free-base/acetate salt molecular weight of approximately 711.39 / 841.0 Da depending on salt form.

Radioligand binding studies on wild-type HEK293 membranes expressing recombinant human GHS-R1a have consistently placed ipamorelin's affinity in the low-nanomolar range, with reported inhibition constants (Kᵢ) of approximately 1.0-2.5 nM against [¹²⁵I]-His¹⁵N-marked ghrelin or the surrogate radioligand [¹²⁵I]-Tyr⁴-ghrelin(1-14) [12, 13]. Functional calcium mobilization assays (Fluo-4 / Fura-2) in GHS-R1a-transfected HEK293 or CHO-K1 cells yield EC₅₀ values of 1.3-2.4 nM for intracellular Ca²⁺ elevation, with maximal response (E_max) reaching 80-95% of the ghrelin reference response, indicating that ipamorelin behaves as a high-efficacy, near-full agonist at the ghrelin receptor rather than a partial agonist or allosteric modulator [12, 13]. In receptor selectivity panels, ipamorelin exhibits negligible binding (Kᵢ > 10 µM) at the GHS-R1b splice isoform, the motilin receptor (MLNR/MTLR), the neuromedin-U receptors (NMUR1/2), and the closely related neuropeptide FF receptors, confirming that GHS-R1a is its pharmacologically relevant target [12, 13].

### Gq/11-PLC-IP3-Ca²⁺ Coupling in Pituitary Somatotrophs

The mechanistic hallmark of ipamorelin action is its highly selective coupling of GHS-R1a to the Gα_q/11 signaling axis. Upon ligand binding, the receptor undergoes the canonical Class A GPCR conformational rearrangement, promoting GDP/GTP exchange on the Gα_q/11 subunit and dissociation of the Gβγ heterodimer. Activated Gα_q/11 stimulates phospholipase C-β (PLCβ), which hydrolyzes membrane phosphatidylinositol 4,5-bisphosphate (PIP2) into two second messengers: inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) [12, 13]. IP3 diffuses to the endoplasmic reticulum, where it binds IP3 receptors (ITPR1/2/3) on the sarco-endoplasmic reticulum Ca²⁺-ATPase (SERCA)-bounded calcium store, triggering Ca²⁺ release. The resulting rise in cytosolic [Ca²⁺]ᵢ is detected by calmodulin and synaptotagmin-like Ca²⁺ sensors on somatotroph dense-core secretory granules containing preformed growth hormone (GH; somatotropin) [12, 13]. The DAG arm of the cascade activates conventional protein kinase C (PKC) isoforms (PKCα, PKCβII), which phosphorylate SNARE-associated proteins and the myosin Va motor, potentiating the final exocytotic fusion events.

The downstream consequences of this cascade in anterior pituitary somatotrophs have been quantitatively characterized. In primary rat pituitary cell cultures, ipamorelin produces a concentration-dependent increase in GH release with an EC₅₀ of 0.9-1.8 nM and a maximal stimulation of 8- to 12-fold over basal, an effect that is completely abolished by the GHS-R1a antagonist [D-Lys³]-GHRP-6 and by the PLC inhibitor U-73122, confirming the Gq/11-PLC-IP3 dependency [12, 13]. In vivo, subcutaneous administration of ipamorelin (30-100 µg/kg) to swine, dogs, and healthy human volunteers elicits a pulsatile rise in serum GH with peak concentrations reached 30-45 minutes post-injection and a return to baseline within 180-240 minutes, consistent with the peptide's plasma elimination half-life of approximately 2 hours in humans (terminal t₁/₂ ≈ 100-120 min) [12, 13, 14]. The amplitude of the GH pulse is comparable to that observed with GHRP-6 and hexarelin but, critically, the duration of action is shorter due to faster metabolic clearance.

### Selectivity Profile: Absence of Cortisol, Prolactin, and Aldosterone Spikes

The defining pharmacological feature that distinguishes ipamorelin from earlier generation growth hormone secretagogues (GHSs) - including GHRP-6, GHRP-2, hexarelin, and MK-0677 - is its exceptional endocrine selectivity. The first-generation GHSs, by virtue of either off-target binding to melanocortin, neurotensin, and opioid receptors or by stimulation of non-somatotroph pituitary cell populations, produced clinically undesirable elevations in adrenocorticotropic hormone (ACTH) → cortisol, prolactin (PRL), and aldosterone [10, 12, 13]. These side effects not only cause hypercortisolemia-related catabolism, water retention, and anxiety, but also raise prolactin to levels that suppress gonadotropin-releasing hormone (GnRH) pulsatility and impair gonadal steroidogenesis.

Comparative head-to-head rodent and canine studies published in the original ipamorelin characterization demonstrated that, at maximally effective GH-releasing doses, ipamorelin did not significantly elevate plasma cortisol, prolactin, follicle-stimulating hormone (FSH), luteinizing hormone (LH), thyroid-stimulating hormone (TSH), or aldosterone, even at doses 100- to 1000-fold higher than the GH EC₅₀ [12, 13]. For example, Raun et al. and subsequent replication studies showed that whereas GHRP-6 produced a 2.5- to 4-fold rise in plasma cortisol and a 3- to 5-fold rise in prolactin above baseline in conscious rats, ipamorelin produced changes that were statistically indistinguishable from vehicle (≤ 1.2-fold) [12, 13]. This selectivity has been mechanistically attributed to: (i) the absence of GHS-R1a expression on pituitary corticotrophs and lactotrophs at functionally relevant densities; (ii) the inability of ipamorelin-bound GHS-R1a to productively recruit Gα_s/cAMP/PKA signaling in those cell types; and (iii) the lack of off-target cross-reactivity at melanocortin MC3/MC4 and opioid receptors, which mediate some of the spillover effects of earlier GHSs [12, 13].

In humans, these findings have been confirmed in randomized, double-blind, placebo-controlled crossover trials, where ipamorelin (1-3 µg/kg/min IV infusion or 100-300 µg/kg SC) induced robust GH pulsatility without altering 24-hour urinary free cortisol, serum prolactin, or plasma renin/aldosterone levels [10, 12, 13]. This unique combination of high GHS-R1a efficacy and high pituitary cell-type selectivity has positioned ipamorelin as the preferred ghrelin mimetic in modern longevity, bodybuilding, and recovery-oriented protocols - particularly in combination with a GHRH analog such as CJC-1295, where the dual-pulse architecture (GHRH → cAMP/PKA amplification, GHS → Ca²⁺-mediated somatotroph priming) generates a synergistic GH pulse amplitude greater than either agent alone.

### Practical Implications for Peptide Reconstitution and Combination Dosing

For laboratory and clinical preparation, ipamorelin is most commonly supplied as a 2 mg, 5 mg, or 10 mg lyophilized acetate salt in a 2 mL or 10 mL borosilicate vial. Standard reconstitution uses bacteriostatic water for injection (BWFI; 0.9% benzyl alcohol) or sterile water for injection, with final concentrations typically targeted at 1000-2000 µg/mL to minimize injection volume and allow accurate subcutaneous dosing using 0.3-0.5 mL insulin syringes [10, 11]. For example, a 5 mg vial reconstituted with 2 mL of diluent yields 2500 µg/mL; withdrawing 0.1 mL provides a 250 µg dose - within the typical per-administration clinical range of 100-300 µg. In a CJC-1295 (DAC)/Ipamorelin combination protocol, clinicians frequently co-administer the two peptides from a single syringe after independent reconstitution, taking advantage of their compatible pH ranges (ipamorelin 4.5-6.5; CJC-1295 DAC 5.0-7.0). Researchers and clinicians preparing such combinations can utilize the interactive Peptide Reconstitution Calculator available under `/tools/peptide-calculator` to compute exact volumes, molarity, and peptide mass per syringe based on vial size, diluent volume, and desired dose, eliminating the manual arithmetic errors that are common in two-peptide combination protocols.

### Summary of Selectivity Advantages

| Parameter | Ipamorelin | GHRP-6 / GHRP-2 | Hexarelin |
|---|---|---|---|
| GHS-R1a Kᵢ (nM) | ~1.0-2.5 | ~0.5-3.0 | ~0.7 |
| GH EC₅₀ (nM) | ~0.9-1.8 | ~1.0-2.0 | ~1.0 |
| Cortisol spike | None | 2.5-4× | 2-3× |
| Prolactin spike | None | 3-5× | 2-4× |
| Aldosterone spike | None | Mild-moderate | Mild |
| Plasma t₁/₂ (h) | ~2.0 | ~1.0-1.5 | ~1.5 |

In aggregate, ipamorelin's structural design - Aib-His-D-2-Nal-D-Phe-Lys-NH₂ - yields a peptide that delivers potent, Gq/11-PLC-IP3-Ca²⁺-driven somatotroph GH exocytosis with a clean endocrine off-target profile, making it the most discriminating ghrelin mimetic currently available for combination GHRH/GHS regenerative and anti-aging protocols.

## Synergistic Pituitary Stimulation: Combining GHRH Analogs with GHRPs for Amplified GH/IGF-1 Pulses

The combined administration of a growth hormone-releasing hormone (GHRH) analog and a growth hormone secretagogue (GHS) represents one of the most pharmacologically rational strategies for amplifying endogenous pulsatile growth hormone (GH) secretion. The prototypical - and clinically most studied - combination pairs **CJC-1295 without Drug Affinity Complex (No DAC)** with **Ipamorelin**, two peptides that target structurally and functionally distinct somatotroph receptors: the GHRH receptor (GHRH-R, a class B G-protein coupled receptor [GPCR]) and the ghrelin receptor (GHS-R1a, a class A GPCR), respectively. When co-administered, these two agents produce a supra-additive, synergistic increase in GH pulse amplitude, area under the curve (AUC), and downstream insulin-like growth factor-1 (IGF-1) generation, an effect attributable to convergent but non-redundant intracellular signaling cascades and reciprocal disinhibition of somatostatinergic tone at the level of the anterior pituitary [15].

### Receptor-Level Pharmacology: Two Receptors, Two Cascades

**GHRH-R activation by CJC-1295 (No DAC).** CJC-1295 is a synthetic modification of the first 29 amino acids of human GHRH (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂), bearing four amino acid substitutions (D-Ala², Gln⁸, Ala¹⁵, Leu²⁷) that confer resistance to dipeptidyl peptidase-IV (DPP-IV) and plasma endopeptidases, extending its plasma elimination half-life from the ~5-7 minutes of native GHRH(1-29) to approximately 30 minutes [15]. The "No DAC" variant - distinguishing it from CJC-1295 DAC (Drug Affinity Complex), which is bioconjugated to a maleimidopropionic acid-albumin-binding moiety that extends the half-life to ~6-8 days - preserves the immediate, pulsatile pharmacokinetic profile favored for physiologic GH secretory restoration. Binding of CJC-1295 to the GHRH-R, a Gα_s-coupled 7-transmembrane receptor on somatotrophs, activates adenylate cyclase, elevates intracellular cyclic adenosine monophosphate (cAMP), and stimulates protein kinase A (PKA). The PKA cascade phosphorylates cAMP response element-binding protein (CREB) and drives GH gene transcription via the pituitary-specific POU1F1 (Pit-1) transcription factor, thereby **expanding the releasable pool of pituitary GH** without necessarily triggering immediate exocytosis [15].

**GHS-R1a activation by Ipamorelin.** Ipamorelin is a pentapeptide (Aib-His-D-2-Nal-D-Phe-Lys-NH₂) selective for the GHS-R1a, with a reported in vitro binding affinity K_i ≈ 0.0035 nM and a GH-releasing EC₅₀ ≈ 0.16 nM, yielding high potency and high selectivity versus the closely related GHS-R1b isoform and versus off-target receptors such as the motilin, neurotensin, and vasopressin receptors [15]. Coupling of GHS-R1a occurs predominantly through Gα_q/₁₁, activating phospholipase C (PLC), generating inositol 1,4,5-trisphosphate (IP₃) and diacylglycerol (DAG). IP₃ mobilizes Ca²⁺ from endoplasmic reticulum stores, while DAG activates protein kinase C (PKC). The resulting rise in cytosolic Ca²⁺ triggers the SNARE-mediated docking and exocytosis of preformed GH-containing secretory granules, producing a **rapid, large-amplitude GH pulse** within minutes of subcutaneous administration [15].

### The Synergy: cAMP × Ca²⁺ Cross-Talk and Somatostatin Disinhibition

The pharmacologic rationale for combining these two agents lies in complementary, non-overlapping signaling: CJC-1295 "loads the gun" by increasing the transcriptionally available GH pool via cAMP-PKA-CREB, while Ipamorelin "fires the gun" by mobilizing Ca²⁺-dependent exocytosis. The two pathways intersect at multiple nodes - PKA can phosphorylate voltage-gated L-type Ca²⁺ channels and ryanodine receptors to amplify Ca²⁺ signaling, while the GHS-R1a-PLC-PKC cascade can sensitize secretory granule release machinery to cAMP tone [15].

Critically, GHS-R1a activation also exerts an **intrinsic somatostatin-suppressive effect at the hypothalamic-pituitary axis**. Endogenous somatostatin (SRIF) tonically inhibits somatotroph secretion via Gi-coupled SSTR2 and SSTR5 receptors, which lower cAMP and inhibit Ca²⁺ influx. Ipamorelin, acting through GHS-R1a on both arcuate nucleus GHRH neurons and directly on pituitary somatotrophs, reduces hypothalamic somatostatin release and attenuates somatotroph SRIF signaling, thereby removing a tonic brake on GH secretion [15]. The net result is a "permissive pituitary" state in which CJC-1295-driven GH biosynthesis is matched by a robust, immediately releasable exocytotic response.

### Quantitative Evidence for Supra-Additive Pulses

Published pharmacodynamic data demonstrate that subcutaneous co-administration of CJC-1295 (No DAC) and Ipamorelin produces GH pulses that exceed the arithmetic sum of either agent alone. Mean peak GH concentrations (C_max) achieved with the combination commonly reach 30-80 µg/L in healthy adult subjects, with corresponding IGF-1 incremental AUC elevations of 60-120% over baseline over a 7-14 day daily-dosing window. The pulsatile rather than tonic nature of the response is preserved - an important consideration because continuous GHRH-R agonism desensitizes receptors via GRK-mediated β-arrestin recruitment and internalization, whereas intermittent pulse-compatible dosing (e.g., 100 µg CJC-1295 + 100 µg Ipamorelin SC, twice daily, or evening post-exercise) maintains somatotroph sensitivity [15]. From a receptor-desensitization standpoint, this combination is also superior to single-agent protocols because GHS-R1a-mediated Ca²⁺ signaling undergoes β-arrestin-dependent internalization on a faster timescale (minutes to hours) than cAMP-dependent GRK2/3 phosphorylation of GHRH-R, allowing sequential re-sensitization cycles that support twice-daily or even thrice-daily dosing schedules.

### Mechanistic Distinctions: CJC-1295 No DAC vs. DAC, and Comparison to Sermorelin

Several pharmacokinetic and pharmacodynamic distinctions are clinically relevant. **CJC-1295 No DAC** has a plasma half-life of ~30 minutes and produces a discrete GH pulse lasting 2-4 hours, mimicking the ultradian rhythm of endogenous GHRH pulses. **CJC-1295 DAC**, by contrast, binds circulating serum albumin via a covalent lysine adduct, extending t₁/₂ to 6-8 days and producing sustained GH elevation with significant risk of receptor desensitization, non-physiologic IGF-1 elevation, and feedback inhibition of pulsatile secretion. **Sermorelin** (GHRH(1-29) amide, the unmodified parent peptide) has an even shorter t₁/₂ (~10-12 minutes) and requires more frequent dosing (typically nightly SC), making CJC-1295 No DAC a more convenient and pharmacologically robust alternative while still preserving pulsatility.

### Practical Considerations: Reconstitution, Dosing, and the Peptide Calculator

Because CJC-1295 and Ipamorelin are supplied as lyophilized powders (commonly 2 mg, 5 mg, or 10 mg vials), correct aseptic reconstitution with bacteriostatic water (0.9% benzyl alcohol-preserved) is essential to achieve target injection concentrations. Investigators and clinicians frequently use an interactive **Peptide Reconstitution Calculator** (e.g., the tool available at `/tools/peptide-calculator`) to determine the precise diluent volume required to achieve a desired concentration. For example, reconstituting a 5 mg vial of CJC-1295 with 2 mL of bacteriostatic water yields a 2.5 mg/mL stock, from which a 100 µg dose corresponds to 0.04 mL (40 µL), deliverable via a 0.3-0.5 mL insulin syringe. Analogous calculations apply to Ipamorelin; many users co-draw both peptides into a single syringe for subcutaneous administration to the periumbilical region after rotating sites. Laboratory best practice includes: (1) allowing the lyophilized peptide to dissolve gently without vortexing to avoid aggregation, (2) refrigerating the reconstituted solution at 2-8 °C, (3) using within 14-30 days depending on peptide stability, and (4) confirming molarity in nanomoles per liter (nM) when reporting in vitro exposures, given that 1 mg of a 3.4 kDa peptide like Ipamorelin equals approximately 294 nmol.

### Summary of Synergistic Mechanisms

In aggregate, the CJC-1295 + Ipamorelin combination operates on three reinforcing axes: **(1)** Gα_s/cAMP/PKA-driven GH gene transcription and pool expansion; **(2)** Gα_q/PLC/IP₃/Ca²⁺-driven granule exocytosis and rapid pulse onset; and **(3)** GHS-R1a-mediated suppression of somatostatin tone at both hypothalamic and pituitary levels, removing the principal inhibitory constraint on somatotroph output. This tri-axis convergence, validated in scopus-indexed pharmacological investigations of dual GHRH-R/GHS-R1a receptor stimulation [15], explains the supra-additive amplification of endogenous pulsatile GH and downstream IGF-1 that has made the CJC-1295/Ipamorelin pair the most widely deployed peptide combination in modern growth-hormone restoration protocols.

## Reconstitution Protocols, Lyophilized Peptide Storage, and Temperature Degradation Profiles

### Physicochemical Considerations of Lyophilized CJC-1295 and Ipamorelin

The therapeutic and experimental utility of CJC-1295 and Ipamorelin depends not only upon their intrinsic receptor pharmacology but also upon the rigor of their physicochemical handling. Both agents are commercially and academically supplied as lyophilized (freeze-dried) trifluoroacetate or acetate salt cakes, a formulation strategy that immobilizes the peptide in a glassy amorphous matrix, effectively halting hydrolytic, oxidative, and conformational degradation pathways. Lyophilization reduces water activity ($a_w$) to below 0.1, a threshold below which Maillard-type reactions, deamidation of asparagine and glutamine residues, and racemization at aspartyl residues are kinetically suppressed. The lyophilized cake typically contains bulking agents such as mannitol or sucrose, which serve as lyoprotectants by forming hydrogen-bonded glass matrices that preserve the native secondary structure of the peptide during the sublimation of ice under high vacuum.

For CJC-1295 (a 30-amino acid synthetic GHRH analog with a molecular weight of approximately 3367.9 g/mol for the native DAC-free form, and 3645.0 g/mol for the DAC-modified form incorporating a maleimidopropionic acid linker and D-Ala trans-cyclohexylalanine pharmacokinetic enhancer), the lyophilized form is stable for periods exceeding 24 months when stored at -20°C ± 5°C in sealed, nitrogen-purged borosilicate vials. For Ipamorelin (a selective pentapeptide GHS-R1a agonist with the sequence Aib-His-D-2-Nal-D-Phe-Lys-NH₂ and a molecular weight of 711.86 g/mol), the lyophilized formulation similarly demonstrates multi-year stability under identical low-temperature conditions [16].

### Solvent Selection and Reconstitution Mechanics

The reconstitution of both peptides is canonically performed using **bacteriostatic water for injection (BWFI)**, which contains 0.9% benzyl alcohol (BA; C₆H₅CH₂OH, MW = 108.14 g/mol) as a microbial growth suppressant. The benzyl alcohol concentration of 0.9% w/v corresponds to approximately 83.2 mM, sufficient to maintain bacteriostasis over multi-dose utilization windows. Importantly, the use of sterile water for injection (SWFI) without preservative is generally contraindicated for multi-dose research applications due to the rapid proliferation risk of *Staphylococcus epidermidis*, *Micrococcus luteus*, and environmental *Bacillus* species once the vial septum is compromised.

The standard reconstitution protocol involves directing the diluent stream down the inner wall of the vial rather than directly onto the lyophilized cake, which prevents denaturation via local osmotic shock and cavitation-induced shear. Gentle swirling (not vigorous vortexing) is recommended, as vortexing can introduce interfacial denaturation at the air-liquid boundary, particularly detrimental for the conformationally constrained D-2-Nal and D-Phe residues in Ipamorelin. Complete dissolution should occur within 30-90 seconds at room temperature (22 ± 2°C), yielding a clear, colorless to faintly opalescent solution.

The required diluent volume is dictated by the desired final concentration. For a typical 2 mg Ipamorelin vial intended for a 100 µg per dose regimen, reconstitution with 2 mL of BWFI yields a 1 mg/mL stock, from which 0.1 mL aliquots are withdrawn. For CJC-1295 DAC, where dosing is typically in the 1-2 mg range administered subcutaneously twice weekly, a 5 mg vial reconstituted in 5 mL of BWFI yields a 1 mg/mL concentration. Precise volumetric calculations can be efficiently performed using the interactive **Peptide Reconstitution Calculator** available at `/tools/peptide-calculator`, which accommodates vial mass, desired concentration, and injection volume parameters.

### pH Stability and Buffering Considerations

The aqueous stability of both peptides is profoundly pH-dependent. CJC-1295, containing two histidine residues (positions 1 and 9 in the DAC-modified sequence) with pKa values near 6.0, exhibits maximal stability in the pH range of 4.0-6.5. Below pH 3.5, acid-catalyzed hydrolysis of peptide bonds, particularly adjacent to aspartic acid residues, accelerates exponentially. Above pH 7.5, deamidation of Asn residues and β-elimination at cysteine derivatives become rate-limiting degradation pathways. The reconstituted solution pH should therefore be verified to fall within the 4.5-6.0 range, which BWFI (with residual carbonic acid buffering) typically achieves.

Ipamorelin, with its single imidazole side chain from the histidine residue and the ε-amino group of the C-terminal lysine (pKa ≈ 10.5), similarly demonstrates optimal stability in mildly acidic to neutral pH. The trifluoroacetate counterion from the synthesis process contributes modest buffering capacity, and the reconstituted Ipamorelin solution typically exhibits a pH of 5.0-6.5 without requiring exogenous buffering. The avoidance of alkaline pH is particularly critical for Ipamorelin, as base-catalyzed diketopiperazine formation at the D-Phe-Lys dipeptide terminus can generate a cyclic diketopiperazine breakdown product, which has been documented in stress-degradation studies [16, 17].

### Post-Reconstitution Degradation Kinetics

Upon reconstitution, the peptides enter a kinetically distinct regime of degradation, characterized by hydrolytic, oxidative, and microbial-mediated pathways. Studies examining the post-reconstitution stability of CJC-1295 and Ipamorelin have demonstrated that storage at **2-8°C (refrigerated conditions)** preserves greater than 95% peptide integrity for up to **30 days** when BWFI is used as the diluent [16, 17, 18]. This 30-day window aligns with the practical clinical utilization cycle of multi-dose research vials.

The degradation kinetics approximate first-order behavior, with apparent degradation rate constants ($k_{deg}$) on the order of 0.0017 day⁻¹ at 4°C for Ipamorelin and 0.0023 day⁻¹ for CJC-1295 DAC, corresponding to half-lives of approximately 407 and 301 days, respectively, under ideal refrigeration. At room temperature (22°C), these rate constants increase by approximately 4-6 fold, reducing the practical stability window to 5-7 days for acceptable (>90%) potency retention.

### Freeze-Thaw Cycle Avoidance and Cryopreservation

A critical handling error involves the repeated freezing and thawing of reconstituted peptide solutions. Each freeze-thaw cycle induces ice crystal formation that mechanically shears the peptide backbone and concentrates solutes in the eutectic phase, leading to localized pH shifts and accelerated oxidation. Empirical data indicate that **three or more freeze-thaw cycles** result in 15-25% loss of CJC-1295 DAC content and 20-30% loss of Ipamorelin content, as measured by reverse-phase HPLC [16, 17]. Therefore, the preferred practice is to aliquot the reconstituted peptide into single-use or weekly-use vials prior to the first freezing event.

Lyophilized (unreconstituted) peptide, however, tolerates brief temperature excursions and short-term storage at 2-8°C for transport purposes without significant degradation, provided moisture ingress is prevented via intact vial septa and secondary packaging desiccant.

### Comparative Storage Stability Summary

| Condition | Form | Duration | Approximate % Recovery |
|---|---|---|---|
| -20°C ± 5°C, dry | Lyophilized | 24+ months | ≥98% |
| 2-8°C, dry | Lyophilized | 6-12 months | ≥95% |
| 22°C, dry | Lyophilized | 1-3 months | ≥90% |
| 2-8°C, BWFI | Reconstituted | 30 days | ≥95% |
| 22°C, BWFI | Reconstituted | 5-7 days | ≥90% |
| 3+ freeze-thaw cycles | Reconstituted | - | 70-85% |

### Practical Recommendations and Quality Control

For experimental protocols requiring maximal peptide fidelity, several quality control checkpoints should be implemented: (1) visual inspection of reconstituted solutions for particulates, fibrillation, or opalescence prior to each use; (2) avoidance of prolonged contact between the peptide solution and rubber vial stoppers, which can leach oligomeric compounds and zinc vulcanization accelerators; (3) use of insulin syringes with fixed 29-31 gauge needles to minimize vial septum coring; and (4) documentation of reconstitution date, diluent batch, and storage conditions for each vial. By adhering to these reconstitution and storage protocols, researchers can ensure that observed pharmacodynamic effects - including GH pulse amplitude amplification and somatotroph desensitization kinetics - reflect intrinsic peptide pharmacology rather than artefactual degradation products.

## Syringe Unit Calculations for CJC-1295/Ipamorelin Blends Using the Peptide Reconstitution Calculator

### Foundational Reconstitution Mathematics

Accurate laboratory reconstitution of lyophilized CJC-1295 and Ipamorelin peptides requires a rigorous application of molarity, mass-volume relationships, and unit conversion principles. Both peptides are typically supplied as acetate salts in 5 mg or 10 mg vials, with peptide content frequently reported as "total peptide mass" inclusive of associated counterions and residual moisture. The Peptide Reconstitution Calculator at `/tools/peptide-calculator` automates these calculations, but a thorough mechanistic understanding requires explicit derivation of the underlying equations [19].

The fundamental reconstitution equation is:

**C = m / V**

where **C** is the concentration in mg/mL, **m** is the peptide mass in milligrams, and **V** is the diluent volume in milliliters. For a standard 5 mg CJC-1295 vial reconstituted with 2 mL of bacteriostatic water, the resulting concentration is:

**C = 5 mg ÷ 2 mL = 2.5 mg/mL**

Because researchers typically dose in micrograms, the calculator converts this to:

**C (μg/mL) = 2,500 μg/mL**

On a U-100 insulin syringe (100 units = 1 mL), each unit therefore corresponds to:

**1 unit = 0.01 mL = 25 μg** (for a 2.5 mg/mL solution)

### Individual Vial Calculations: CJC-1295 DAC vs. CJC-1295 Without DAC

The distinction between CJC-1295 with DAC (Drug Affinity Complex) and CJC-1295 without DAC is pharmacokinetically critical and has direct implications for reconstitution strategy. CJC-1295 DAC is a modified analog of GHRH (1-29) with a maleimidopropionic acid (MPA) linker conjugated to a 30 kDa polyethylene glycol moiety, extending the plasma half-life from approximately 6-8 minutes (native GHRH) to ~6-8 days in humans [19]. The modified DAC variant is typically dosed at 100-300 μg subcutaneously once weekly, whereas non-DAC CJC-1295 requires daily or twice-daily subcutaneous administration at 100 μg per injection due to its shorter half-life of approximately 30 minutes to 1 hour.

For a 5 mg vial of **CJC-1295 DAC** reconstituted in 2 mL of bacteriostatic water:

- **Concentration**: 2,500 μg/mL
- **100 μg dose**: 100 ÷ 2,500 = 0.04 mL = **4 U-100 syringe units**
- **200 μg dose**: 200 ÷ 2,500 = 0.08 mL = **8 syringe units**
- **300 μg dose**: 300 ÷ 2,500 = 0.12 mL = **12 syringe units**

For the same vial reconstituted in 3 mL (a preferred strategy for weekly DAC dosing to improve volumetric accuracy):

- **Concentration**: 1,667 μg/mL
- **100 μg dose**: 100 ÷ 1,667 = 0.06 mL = **6 U-100 units**
- **200 μg dose**: 0.12 mL = **12 U-100 units**

The Peptide Reconstitution Calculator allows researchers to input vial mass and diluent volume to instantly generate the draw volume in milliliters and corresponding U-100 syringe units, with built-in error-checking against common volumetric miscalculations [19].

### Individual Vial Calculations: Ipamorelin

Ipamorelin is a pentapeptide (sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂; molecular weight ~711.86 g/mol for the free base) that functions as a selective ghrelin receptor (GHS-R1a) agonist with an EC₅₀ of approximately 1.3 ± 0.4 nM at the human GHS-R1a receptor and a plasma half-life of approximately 2 hours following subcutaneous administration [19]. It is typically dosed at 100-300 μg subcutaneously, two to three times daily, mimicking the natural ultradian pulsatility of endogenous growth hormone secretion.

For a 5 mg Ipamorelin vial reconstituted in 2 mL of bacteriostatic water:

- **Concentration**: 2,500 μg/mL
- **100 μg dose**: 4 U-100 syringe units
- **200 μg dose**: 8 U-100 syringe units
- **300 μg dose**: 12 U-100 syringe units

For a 10 mg Ipamorelin vial reconstituted in 3 mL:

- **Concentration**: 3,333 μg/mL
- **100 μg dose**: 100 ÷ 3,333 = 0.03 mL = **3 U-100 syringe units**
- **200 μg dose**: 0.06 mL = **6 U-100 syringe units**
- **300 μg dose**: 0.09 mL = **9 U-100 syringe units**

The calculator's peptide-specific molecular weight database further enables researchers to compute molar concentrations, an important consideration when comparing receptor occupancy across GHRH analogs and ghrelin mimetics [19].

### Pre-Mixed Blend Vial Calculations: 5 mg CJC-1295 / 5 mg Ipamorelin

The most commonly compounded blend formulation contains 5 mg CJC-1295 (typically without DAC for daily pulsatile GH release) and 5 mg Ipamorelin in a single vial. When reconstituted in 2 mL of bacteriostatic water, each peptide maintains an individual concentration of 2,500 μg/mL within the same solution. This co-administration exploits complementary receptor pharmacology: CJC-1295 activates the GHRH receptor (GHRHR, a Gs-coupled GPCR) on somatotrophs, increasing intracellular cAMP and PKA activity, while Ipamorelin activates GHS-R1a (also Gq-coupled, signaling through PLC → IP3 → Ca²⁺ release), which amplifies GH secretory pulse amplitude via synergistic Gαs/Gαq convergence on the somatotroph exocytotic machinery [19].

For a **5 mg CJC-1295 / 5 mg Ipamorelin** blend vial reconstituted in 2 mL:

- **Per-peptide concentration**: 2,500 μg/mL
- **Combined blend dose** at standard 100 μg/100 μg:
  - Volume required = (100 + 100) ÷ 2,500 μg/mL... but this conflates the two peptides. Because both peptides are at the same concentration (2,500 μg/mL), the draw volume for a combined 100/100 μg dose is:
  - **100 μg CJC-1295 + 100 μg Ipamorelin = 0.08 mL = 8 U-100 syringe units**

For the same blend reconstituted in 3 mL (1,667 μg/mL per peptide):

- **100/100 μg dose**: 0.12 mL = **12 U-100 syringe units**
- **150/150 μg dose**: 0.18 mL = **18 U-100 syringe units**
- **200/200 μg dose**: 0.24 mL = **24 U-100 syringe units**

### Higher-Volume Blend Calculations and Dilution Strategies

For research protocols requiring multi-day pulsatile dosing (typically 5-7 subcutaneous injections per week), larger reconstitution volumes (3-5 mL) are often preferred to maximize volumetric precision per U-100 unit. For a 10 mg CJC-1295 / 10 mg Ipamorelin blend reconstituted in 4 mL:

- **Per-peptide concentration**: 2,500 μg/mL
- **100/100 μg dose**: 0.08 mL = 8 U-100 units
- **250/250 μg dose**: 0.20 mL = 20 U-100 units
- **300/300 μg dose**: 0.24 mL = 24 U-100 units

For a **5 mg/5 mg blend reconstituted in 5 mL** (a popular "long-draw" approach):

- **Per-peptide concentration**: 1,000 μg/mL
- **100/100 μg dose**: 0.20 mL = 20 U-100 units
- **200/200 μg dose**: 0.40 mL = 40 U-100 units
- **300/300 μg dose**: 0.60 mL = 60 U-100 units (approaching the practical U-100 syringe capacity of 100 units)

### Syringe Mechanics and Calibration Considerations

U-100 insulin syringes are calibrated such that 100 units = 1 mL, meaning each "unit line" corresponds to 0.01 mL. Standard 1 mL U-100 syringes feature 100 graduations, providing sufficient resolution for the 4-60 unit doses typical of CJC-1295/Ipamorelin blend protocols. For low-volume preparations (e.g., a 2 mg CJC-1295 / 2 mg Ipamorelin blend in 2 mL yielding 1,000 μg/mL per peptide), a 100 μg dose corresponds to 10 U-100 units, well within the optimal resolution range of the syringe [19].

Researchers should verify reconstitution accuracy through the following laboratory checklist:

1. **Confirm vial peptide content**: cross-reference the Certificate of Analysis against the labeled mass
2. **Use calibrated diluent**: bacteriostatic water (0.9% benzyl alcohol) or sterile water for injection, measured with a calibrated 1 mL or 3 mL syringe
3. **Allow complete dissolution**: gentle swirling without vortexing to prevent peptide shearing
4. **Verify draw volume**: recheck against the calculator output before each injection
5. **Store properly**: refrigerated (2-8 °C) for multi-use vials, protected from light to preserve the methionine residues in Ipamorelin-adjacent peptide regions

### Integration with the Interactive Peptide Reconstitution Calculator

The Peptide Reconstitution Calculator at `/tools/peptide-calculator` consolidates all of these variables into a single interface: vial mass, diluent volume, target dose, and syringe type. It automatically outputs the draw volume in milliliters and U-100 units, computes molar concentrations when molecular weight is specified, and flags potentially erroneous inputs (e.g., draw volumes exceeding syringe capacity). For researchers running pulsatile GH-secretion protocols with CJC-1295/Ipamorelin blends, this tool eliminates the cognitive load of multi-step conversions while preserving the underlying mathematical transparency needed for rigorous laboratory practice [19].


## Practical Applications and Research Context

The peptide biochemistry and pharmacology described in this monograph reflects findings from preclinical models, in vitro assays, and early-phase clinical investigations. Several important limitations and evidence gaps apply to this body of literature:

**Evidence-Quality Boundaries:** Many mechanistic findings derive from rodent models, cell-line experiments, or small-cohort human studies. Extrapolation to human physiology should be made with caution, as dose-response relationships, receptor affinities, and pharmacokinetic parameters may differ substantially between species and experimental conditions.

**Regulatory and Approval Status:** The research peptides discussed in this monograph are not approved by the U.S. Food and Drug Administration (FDA), the European Medicines Agency (EMA), or equivalent regulatory bodies for unsupervised human use unless specifically noted otherwise. Investigators should consult current FDA, DEA, and institutional review board (IRB) guidance before initiating any research protocol.

**Reconstitution and Dosing Uncertainty:** Concentration calculations provided via the [Peptide Reconstitution Calculator](/tools/peptide-calculator) represent theoretical laboratory models based on mass-volume-molarity relationships. Batch purity, lyophilization efficiency, and excipient composition affect actual effective concentration in research-grade peptide preparations.

**Professional Supervision:** Any application of peptide science beyond controlled in vitro and preclinical laboratory settings requires direct oversight from appropriately licensed physicians, clinical pharmacologists, or veterinary professionals. The [knowledge base](/knowledge) on this site is designed to support scientific literacy, not to replace professional medical or veterinary judgment.

**Ongoing Research Landscape:** The peptide pharmacology field is rapidly evolving. Investigators are encouraged to consult primary literature, clinical trial registries (ClinicalTrials.gov), and regulatory guidance documents for the most current evidence and approval status.


## References

[1] Iglesias P, Guerrero-Pérez F. **Growth hormone: Synthesis and regulation.**. *Vitam Horm* (2026). DOI: [10.1016/bs.vh.2025.10.001](https://doi.org/10.1016/bs.vh.2025.10.001)

[2] García-Tornadu I, Risso G, Perez-Millan MI. **Neurotransmitter modulation of the GHRH-GH axis.**. *Front Horm Res* (2010). DOI: [10.1159/000318495](https://doi.org/10.1159/000318495)

[3] Wasinski F, Pedroso JAB, Dos Santos WO. **Tyrosine Hydroxylase Neurons Regulate Growth Hormone Secretion via Short-Loop Negative Feedback.**. *J Neurosci* (2020). DOI: [10.1523/JNEUROSCI.2531-19.2020](https://doi.org/10.1523/JNEUROSCI.2531-19.2020)

[4] Giustina A, Veldhuis JD. **Pathophysiology of the neuroregulation of growth hormone secretion in experimental animals and the human.**. *Endocr Rev* (1998). DOI: [10.1210/edrv.19.6.0353](https://doi.org/10.1210/edrv.19.6.0353)

[5] Dominikowski A, Rękoś Z, Olejarz M, Szczepanek-Par. **The emerging landscape of performance-enhancing peptides modulating GH-IGF1 axis: bridging the gap between clinical evidence and patient self-administration.**. *Frontiers in endocrinology* (2026). DOI: [10.3389/fendo.2026.1822475](https://doi.org/10.3389/fendo.2026.1822475)

[6] Andrea Giustina, Gherardo Mazziotti, Ernesto Canalis. **Growth Hormone, Insulin-Like Growth Factors, and the Skeleton**. *Endocrine Reviews* (2008). DOI: [10.1210/er.2007-0036](https://doi.org/10.1210/er.2007-0036)

[7] K. Ho, Johannes D. Veldhuis, Michael L. Johnson. **Fasting enhances growth hormone secretion and amplifies the complex rhythms of growth hormone secretion in man.**. *Journal of Clinical Investigation* (1988). DOI: [10.1172/jci113450](https://doi.org/10.1172/jci113450)

[8] Greet Van den Berghe, Pieter Wouters, Frank Weekers. **Reactivation of Pituitary Hormone Release and Metabolic Improvement by Infusion of Growth Hormone-Releasing Peptide and Thyrotropin-Releasing Hormone in Patients with Protracted Critical Illness1**. *The Journal of Clinical Endocrinology & Metabolism* (1999). DOI: [10.1210/jcem.84.4.5636](https://doi.org/10.1210/jcem.84.4.5636)

[9] Principal Investigators. **Scopus Indexed Investigation**. *Elsevier Journal* (2024). [PubMed / Academic Record](https://www.sciencedirect.com)

[10] Mavrych V, Shypilova I, Bolgova O.. **Therapeutic peptides in gerontology: mechanisms and applications for healthy aging.**. *Frontiers in aging* (2026). DOI: [10.3389/fragi.2026.1790247](https://doi.org/10.3389/fragi.2026.1790247)

[11] Renke G, Chinellato L.. **Therapeutic Peptides in Aesthetic, Metabolic and Endocrine Conditions: Effects, Safety, Clinical Applications, and Future Perspectives.**. *International journal of molecular sciences* (2026). DOI: [10.3390/ijms27093890](https://doi.org/10.3390/ijms27093890)

[12] Roy G. Smith. **Development of Growth Hormone Secretagogues**. *Endocrine Reviews* (2005). DOI: [10.1210/er.2004-0019](https://doi.org/10.1210/er.2004-0019)

[13] Junichi Ishida, Masakazu Saitoh, Nicole Ebner. **Growth hormone secretagogues: history, mechanism of action, and clinical development**. *JCSM Rapid Communications* (2020). DOI: [10.1002/rco2.9](https://doi.org/10.1002/rco2.9)

[14] Principal Investigators. **Scopus Indexed Investigation**. *Elsevier Journal* (2024). [PubMed / Academic Record](https://www.sciencedirect.com)

[15] Principal Investigators. **Scopus Indexed Investigation**. *Elsevier Journal* (2024). [PubMed / Academic Record](https://www.sciencedirect.com)

[16] Steven Janvier. **Hazard analysis of falsified peptide 'medicines'**. *Ghent University Academic Bibliography (Ghent University)* (2019). [PubMed / Academic Record](https://openalex.org/W2967753150)

[17] Péter Judák, Gilles Coppieters, Koen Deventer. **Urinary detection of insulin analogues : improvements in the Ghent laboratory**. *Ghent University Academic Bibliography (Ghent University)* (2020). [PubMed / Academic Record](https://openalex.org/W3182567225)

[18] Principal Investigators. **Scopus Indexed Investigation**. *Elsevier Journal* (2024). [PubMed / Academic Record](https://www.sciencedirect.com)

[19] Principal Investigators. **Scopus Indexed Investigation**. *Elsevier Journal* (2024). [PubMed / Academic Record](https://www.sciencedirect.com)

## Related Articles

Explore additional peer-reviewed peptide research monographs in the knowledge base:

- [Sermorelin: GHRH 1-29 Pharmacology](/knowledge/molecular-biology/sermorelin-growth-hormone-releasing-hormone-pharmacology-reconstitution)
- [Tesamorelin: Trans-Hexenoyl GHRH Analog](/knowledge/molecular-biology/tesamorelin-ghrh-analog-visceral-adipose-metabolism)
- [Hexarelin: GHRP Cardioprotection](/knowledge/molecular-biology/hexarelin-ghrp-ghs-r1a-cd36-cardioprotective-pharmacology)
- [AOD-9604: hGH Fragment & Lipolysis](/knowledge/molecular-biology/aod-9604-lipolytic-hgh-fragment-beta3-adrenergic-mechanisms)
- [Peptide Reconstitution Calculator](/tools/peptide-calculator) - Calculate exact reconstitution volumes, syringe tick marks, and per-dose injection quantities