# IFN-gamma: Type II Interferon Homodimer, Macrophage Activation, and Major Histocompatibility Complex Upregulation


## Key Takeaways

- IFN-γ, a Type II interferon, is a homodimeric cytokine produced by NK cells, NKT cells, and T lymphocytes, acting as a master regulator of cell-mediated immunity.
- Its primary mechanism involves binding to the IFNGR1/IFNGR2 receptor complex, activating JAK-STAT signaling to upregulate MHC class I and II molecules and activate macrophages for pathogen clearance.
- Genetic variations, particularly the rs2430561 (+874 T/A) polymorphism, are associated with differential IFN-γ production and susceptibility to infectious diseases like tuberculosis and leprosy, as well as autoimmune conditions.
- Inherited complete IFN-γ deficiency, caused by loss-of-function mutations in *IFNG*, leads to Mendelian Susceptibility to Mycobacterial Disease (MSMD), characterized by severe infections with mycobacteria and *Salmonella*.
- Epigenetic modifications, such as promoter hypermethylation of the *IFNG* gene in tumor-infiltrating lymphocytes, contribute to immune evasion in cancer and are implicated in autoimmune thyroid diseases and recurrent oral ulcers.
- IFN-γ plays a dual role in cancer, promoting anti-tumor immunity but also inducing immune checkpoint molecules like PD-L1, contributing to adaptive immune resistance and immunotherapy challenges.

---

## Executive Summary & Key Metadata

Interferon-gamma (IFN-γ), encoded by the *IFNG* gene, is the sole member of the Type II interferon family and functions as a critical master regulator of innate and adaptive immunity. Unlike Type I interferons (IFN-α/β), which are induced ubiquitously in response to viral infection, IFN-γ is produced predominantly by natural killer (NK) cells, natural killer T (NKT) cells, and CD4⁺ Th1 and CD8⁺ cytotoxic T lymphocytes upon antigen recognition. The secreted cytokine operates as a non-covalent homodimer that binds to a distinct heterodimeric receptor complex (IFNGR1/IFNGR2), activating the JAK-STAT signaling axis to drive macrophage activation, upregulation of Major Histocompatibility Complex (MHC) class I and II molecules, and the orchestration of cell-mediated immunity against intracellular pathogens and tumors.

| **Attribute** | **Value** |
|---|---|
| **HGNC Symbol** | IFNG |
| **UniProt Accession** | P01579 |
| **Representative PDB ID** | 1HIG |
| **Chromosomal Locus** | 12q15 (human); 10q24 (mouse) |
| **Primary Molecular Function** | Cytokine activity; Type II interferon receptor binding; macrophage activation; MHC class I/II upregulation |
| **Key Signaling Pathways** | JAK-STAT (JAK1/JAK2 → STAT1), IRF1, NF-κB, PI3K/AKT |
| **Disease & Pathology Associations** | Mendelian Susceptibility to Mycobacterial Disease (MSMD), tuberculosis, leprosy, rheumatoid arthritis, inflammatory bowel disease, psoriasis, atopic dermatitis, cancer immune evasion, autoimmune thyroid disease |

The *IFNG* gene is located on the long arm of chromosome 12 (12q15), a region frequently amplified in human sarcomas and gliomas. The gene spans approximately 5.4 kilobases (kb) and contains four exons and three introns. The mature protein is 166 amino acids in length (after signal peptide cleavage), with a molecular weight of approximately 17 kDa per monomer; the biologically active form is a non-covalent homodimer of approximately 34–40 kDa (glycosylated). The [protein structure](/knowledge/bioinformatics/protein-structure-biophysical-levels-folding) is characterized by an alpha-helical bundle topology, a feature shared with other helical cytokines but distinct from the beta-sheet-rich Type I interferons.

This reference manual provides an exhaustive technical analysis of the *IFNG* gene, from its genomic architecture and transcriptional regulation to its three-dimensional protein structure, signal transduction cascades, pathogenic mutations, and clinical relevance in infectious disease, autoimmunity, and oncology. The document integrates structural biology, immunology, genetics, and [pharmacogenomics](/knowledge/bioinformatics/pharmacogenomics-tailoring-drugs-to-genetic-profiles) to serve as a definitive resource for researchers and clinicians.

---

## 1. Genomic Locus, Chromosomal Organization & Isoforms

### 1.1 Chromosomal Localization and Gene Structure

The human *IFNG* gene (NCBI Gene ID: 3458; Ensembl: ENSG00000111537) maps to chromosome 12q15, a cytogenetic band that is gene-dense and evolutionarily conserved across mammals. The gene spans approximately 5,400 base pairs (bp) of genomic DNA and is oriented on the plus strand. The gene structure comprises four exons (Exon 1: 5' UTR and signal peptide; Exon 2: N-terminal region; Exon 3: central core; Exon 4: C-terminal region and 3' UTR) and three introns. The canonical transcript (ENST00000229135) is 1,242 nucleotides in length, encoding a 166-amino-acid mature protein following cleavage of a 23-amino-acid signal peptide.

The *IFNG* locus resides within a cytokine gene cluster on 12q15, flanked by *IL26* and *IL22* upstream and *MDM1* downstream. This genomic neighborhood is notable for its evolutionary conservation of synteny, with the orthologous mouse gene (*Ifng*) located on chromosome 10q24. The 3' untranslated region (UTR) of *IFNG* contains multiple AU-rich elements (AREs) that regulate mRNA stability; these AREs are critical for the rapid degradation of IFN-γ transcripts in resting T cells and their stabilization upon T-cell receptor (TCR) engagement.

### 1.2 Promoter Architecture and Transcription Factor Binding Sites

The proximal promoter of *IFNG* lacks a canonical TATA box but contains multiple cis-regulatory elements that integrate signals from TCR engagement, cytokine receptors, and co-stimulatory molecules. Key transcription factor binding sites within the proximal promoter (−280 to +1 bp relative to the transcription start site) include:

- **NF-AT (Nuclear Factor of Activated T cells)**: Binding sites at approximately −280, −160, and −90 bp. NF-AT cooperates with AP-1 to drive calcium-dependent *IFNG* transcription following TCR stimulation.
- **AP-1 (Activator Protein-1)**: Sites at −180 and −120 bp, mediating responses to PKC and MAPK signaling.
- **STAT4 (Signal Transducer and Activator of Transcription 4)**: A binding site at −230 bp that responds to IL-12 receptor signaling, a critical driver of Th1 differentiation.
- **T-bet (TBX21)**: While T-bet primarily binds distal enhancers, it also interacts with the proximal promoter to recruit chromatin remodeling complexes and [RNA Polymerase](/knowledge/bioinformatics/rna-polymerase-structure-transcription-mechanisms) II.
- **GATA-3**: A repressive binding site at −160 bp; GATA-3 binding inhibits *IFNG* transcription in Th2 cells, establishing the Th1/Th2 transcriptional antagonism.
- **YY1 (Yin Yang 1)**: A binding site at −100 bp that contributes to basal transcriptional activity.

### 1.3 Distal Regulatory Elements and Enhancers

The *IFNG* locus is regulated by a complex array of distal cis-regulatory elements that undergo dynamic chromatin remodeling during T helper cell differentiation. These elements include:

- **CNS-22 (Conserved Noncoding Sequence at −22 kb)**: A highly conserved enhancer located 22 kb upstream of the transcription start site. Deletion of CNS-22 in mice results in a significant reduction in *Ifng* expression in Th1 cells and NK cells, highlighting its essential role in lineage-specific expression. CNS-22 contains binding sites for T-bet, STAT4, and NF-κB (RelA).
- **CNS-34 (at −34 kb)**: A distal enhancer that interacts with the promoter via chromatin looping in Th1 cells. This element is marked by histone H3K4me1 and H3K27ac in differentiated Th1 cells but remains in a poised state in naive T cells.
- **CNS+20 (at +20 kb)**: A downstream enhancer located within the first intron of the neighboring *IL26* gene. This element contributes to maximal *IFNG* expression and is bound by STAT4 and T-bet.
- **CNS-54 (at −54 kb)**: A matrix attachment region (MAR) that anchors the *Ifng* locus to the nuclear matrix, facilitating the formation of a transcriptionally active chromatin loop.

The three-dimensional organization of the *Ifng* locus undergoes profound changes during Th1 differentiation. In naive CD4⁺ T cells, the locus adopts a closed conformation with limited promoter-enhancer interactions. Upon TCR stimulation and IL-12 signaling, the locus undergoes loop formation, bringing distal enhancers (CNS-22, CNS-34) into proximity with the proximal promoter. This looping is dependent on the transcription factor T-bet and is associated with the recruitment of [RNA Polymerase](/knowledge/bioinformatics/rna-polymerase-structure-transcription-mechanisms) II and the establishment of long-range histone acetylation domains.

### 1.4 Epigenetic Regulation

Epigenetic modifications play a central role in the cell-type-specific and activation-dependent regulation of *IFNG* expression:

- **Histone Acetylation**: Th1 differentiation is associated with the acquisition of histone H3 and H4 acetylation across the *Ifng* locus, including the promoter and distal enhancers. This hyperacetylation is mediated by histone acetyltransferases (HATs) recruited by T-bet and STAT4 and is essential for chromatin decondensation and transcriptional competence.
- **Histone Methylation**: The locus is marked by H3K4me3 at the promoter and H3K4me1 at enhancers in Th1 cells, while repressive marks (H3K27me3) are deposited in Th2 cells by the Polycomb repressive complex 2 (PRC2).
- **DNA Methylation**: CpG methylation of the *IFNG* promoter is a critical mechanism of transcriptional silencing. In naive T cells and Th2 cells, the promoter is hypermethylated, whereas Th1 differentiation is accompanied by active demethylation of CpG dinucleotides. Aberrant hypermethylation of the *IFNG* promoter has been documented in tumor-infiltrating lymphocytes (TILs), contributing to immunosuppression in the tumor microenvironment. Similarly, chronic exposure to environmental toxins such as trichloroethylene (TCE) increases *Ifng* promoter methylation in CD4⁺ T cells, leading to altered IFN-γ production. In autoimmune thyroid diseases, *IFNG* gene methylation levels in peripheral blood cells correlate with disease severity and prognosis. In recurrent oral ulcers (ROU), *IFNG* methylation is associated with Th1/Th2 imbalance.
- **Long Noncoding RNAs (lncRNAs)**: The *IFNG* locus produces a lncRNA, *IFNG-AS1* (also known as *NeST*), which is transcribed from the antisense strand and functions as an enhancer-like RNA that promotes *IFNG* transcription. *IFNG-AS1* is upregulated in Th1 cells and is required for optimal IFN-γ production. Dysregulation of *IFNG-AS1* has been implicated in autoimmune diseases (rheumatoid arthritis, ulcerative colitis, inflammatory bowel disease) and cancers. In breast cancer, *IFNG-AS1* expression is elevated and correlates with poor prognosis. In autism spectrum disorder, the balance between *IFNG* and *IFNG-AS1* expression is disrupted. In Crimean-Congo hemorrhagic fever, *IFNG-AS1* and related lncRNAs (*NEAT1*, *NRIR*) show altered expression.

### 1.5 Isoforms and Splice Variants

The *IFNG* gene produces a single canonical protein-coding transcript. However, several alternative splice variants have been reported:

- **IFNG-001 (Canonical)**: Encodes the full-length 193-amino-acid precursor protein (including signal peptide), which is processed to the 166-amino-acid mature cytokine.
- **IFNG-002**: A variant lacking exon 2, resulting in a truncated protein that is predicted to be non-functional due to loss of the N-terminal receptor-binding domain. This variant is expressed at low levels in activated T cells and may exert a dominant-negative effect.
- **IFNG-003**: A variant retaining intron 3, which introduces a premature stop codon. This transcript is subject to nonsense-mediated decay (NMD) and is unlikely to produce a stable protein.

The functional significance of these splice variants remains incompletely characterized, but they may contribute to the fine-tuning of IFN-γ bioavailability in specific cellular contexts.

---

## 2. 3D Protein Domain Architecture & Structural Biology

### 2.1 Primary Structure and Post-Translational Modifications

The human IFN-γ precursor is 193 amino acids in length. The N-terminal 23 amino acids constitute a hydrophobic signal peptide that directs the protein to the secretory pathway. The mature protein (166 amino acids; residues 24–193 of the precursor) has a calculated molecular weight of 17.1 kDa per monomer. The mature protein contains two potential N-linked glycosylation sites (Asn25 and Asn97 in the mature sequence), and the secreted cytokine is variably glycosylated, resulting in heterogeneous molecular weights of 20–25 kDa per monomer on SDS-PAGE.

The amino acid sequence of mature human IFN-γ is:

```
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
```

Key structural features include:
- **C-terminal basic region (residues 128–166)**: A highly basic, lysine- and arginine-rich domain that is essential for receptor binding and biological activity. This region is susceptible to proteolytic cleavage by matrix metalloproteinases (MMPs), which can inactivate the cytokine.
- **Nuclear localization signal (NLS)**: The C-terminal region contains a bipartite NLS (residues 140–166) that mediates translocation of IFN-γ to the nucleus in some cell types, where it may exert direct transcriptional effects.

### 2.2 Secondary and Tertiary Structure

The three-dimensional structure of human IFN-γ has been determined by X-ray crystallography (PDB: 1HIG) at 2.0 Å resolution. The monomer adopts an alpha-helical bundle topology consisting of six alpha-helices (designated A through F) connected by loops. The helices are arranged in an antiparallel fashion, forming a compact, elongated structure of approximately 40 Å × 30 Å × 20 Å.

The secondary structure elements are as follows:
- **Helix A**: Residues 10–28 (mature numbering)
- **Helix B**: Residues 36–52
- **Helix C**: Residues 58–75
- **Helix D**: Residues 84–105
- **Helix E**: Residues 110–127
- **Helix F**: Residues 132–155

The loops connecting these helices are relatively short, with the exception of the long loop between helices A and B, which contains the first glycosylation site.

### 2.3 Quaternary Structure: The Functional Homodimer

The biologically active form of IFN-γ is a non-covalent homodimer. In the crystal structure (1HIG), the two monomers associate in an antiparallel orientation, forming a globular dimer with dimensions of approximately 60 Å × 40 Å × 30 Å. The dimer interface is extensive, burying approximately 2,500 Ų of solvent-accessible surface area per monomer. The interface is stabilized by:
- **Hydrophobic interactions**: Clustering of leucine, isoleucine, and valine residues at the dimer interface.
- **Hydrogen bonds**: A network of polar contacts between backbone and side-chain atoms.
- **Electrostatic interactions**: Salt bridges between oppositely charged residues across the interface.

The dimeric structure creates two symmetric receptor-binding sites, each composed of residues from both monomers. This bivalent architecture allows a single IFN-γ dimer to engage two IFNGR1 receptor chains simultaneously, a prerequisite for receptor dimerization and signal transduction.

### 2.4 Receptor Binding and Structural Determinants of Specificity

IFN-γ signals through a heterotetrameric receptor complex consisting of two IFNGR1 (ligand-binding) chains and two IFNGR2 (signal-transducing) chains. The structural determinants of IFN-γ/IFNGR1 interaction have been mapped by mutagenesis and structural studies:

- **Site 1 (High-affinity binding site)**: The primary receptor-binding site is formed by residues from the C-terminal region (helices E and F) of one monomer and the N-terminal region (helix A) of the other. Key residues include Lys108, Glu112, Lys128, and Arg132. Mutation of these residues abolishes receptor binding and biological activity.
- **Site 2 (Low-affinity site)**: A secondary binding site on the opposite face of the dimer contributes to receptor cross-linking and signal amplification.

The species specificity of IFN-γ is determined by residues in the C-terminal region; human IFN-γ is inactive on mouse cells and vice versa, reflecting co-evolution of the cytokine and its receptor.

### 2.5 Interactive 3D Visualization

For a comprehensive structural analysis, including the spatial arrangement of the homodimer, receptor-binding interfaces, and post-translational modification sites, the interactive 3D visualizer is recommended:

[Interactive 3D Protein Visualizer: Load IFNG (PDB: 1HIG)](/tools/protein-structure-viewer?source=direct&pdbId=1HIG)

This tool enables rotation, zoom, and residue-level inspection of the crystallographic structure, facilitating the identification of key functional epitopes and mutation hotspots.

---

## 3. Cellular Signaling Pathways & Molecular Function

### 3.1 The IFN-γ Receptor Complex

IFN-γ exerts its biological effects by binding to a cell-surface receptor complex composed of two structurally related but functionally distinct subunits:

- **IFNGR1 (Interferon Gamma Receptor 1; CD119)**: A 90-kDa (unglycosylated 55-kDa) type I transmembrane protein encoded by *IFNGR1* on chromosome 6q23-q24. IFNGR1 is the ligand-binding chain, exhibiting high-affinity binding to IFN-γ (Kd ≈ 10⁻⁹–10⁻¹⁰ M). The intracellular domain of IFNGR1 contains the binding site for JAK1 and a STAT1 recruitment motif (Y440).
- **IFNGR2 (Interferon Gamma Receptor 2; AF-1)**: A 62-kDa (unglycosylated 35-kDa) type I transmembrane protein encoded by *IFNGR2* on chromosome 21q22.1. IFNGR2 is the signal-transducing chain, associating with JAK2. IFNGR2 does not bind IFN-γ directly but is required for signal transduction.

Both receptor chains belong to the class II cytokine receptor family, characterized by fibronectin type III (FNIII) domains in their extracellular regions.

### 3.2 JAK-STAT Signaling Cascade

The canonical IFN-γ signaling pathway proceeds through the JAK-STAT axis:

1. **Ligand-induced receptor dimerization**: Binding of the IFN-γ homodimer to two IFNGR1 chains induces the recruitment of two IFNGR2 chains, forming a functional heterotetrameric complex.
2. **JAK activation**: The juxtaposition of JAK1 (constitutively associated with IFNGR1) and JAK2 (constitutively associated with IFNGR2) within the receptor complex leads to their trans-phosphorylation and activation. JAK2 phosphorylates JAK1, and both kinases become catalytically active.
3. **Receptor phosphorylation**: Activated JAKs phosphorylate specific tyrosine residues on the intracellular domain of IFNGR1, primarily Tyr440. This creates a docking site for STAT1.
4. **STAT1 recruitment and phosphorylation**: STAT1 (Signal Transducer and Activator of Transcription 1) binds via its SH2 domain to the phosphorylated Y440 motif. JAK2 then phosphorylates STAT1 at Tyr701.
5. **STAT1 dimerization and nuclear translocation**: Phosphorylated STAT1 (pSTAT1) dissociates from the receptor, forms homodimers (or heterodimers with STAT2 in some contexts), and translocates to the nucleus via importin-α/β.
6. **Transcriptional activation**: In the nucleus, pSTAT1 homodimers bind to gamma-activated sequences (GAS) in the promoters of IFN-γ-responsive genes, driving their transcription.

The GAS consensus sequence is TTCNNNGAA. Genes directly induced by STAT1 include:
- **IRF1 (Interferon Regulatory Factor 1)**: A master transcription factor that amplifies the IFN-γ response by inducing a secondary wave of gene expression.
- **GBP1/2 (Guanylate-Binding Proteins)**: GTPases involved in antimicrobial defense.
- **CXCL9, CXCL10, CXCL11**: Chemokines that recruit CXCR3⁺ T cells.
- **MHC class I and II genes**: Including *[HLA-A](/knowledge/bioinformatics/genes/immunology-checkpoints/hla-a-gene-structure-function-pathway)*, *HLA-B*, *HLA-C*, *HLA-DRA*, *HLA-DRB1*, and the class II transactivator *CIITA*.

### 3.3 Non-Canonical Signaling Pathways

Beyond the canonical JAK-STAT pathway, IFN-γ activates several alternative signaling cascades:

- **PI3K/AKT Pathway**: IFN-γ can activate phosphatidylinositol 3-kinase (PI3K) and AKT, promoting cell survival and proliferation in certain cell types.
- **MAPK Pathways**: IFN-γ activates p38 MAPK and ERK1/2 in a cell-type-specific manner. p38 MAPK activation is required for IFN-γ-induced expression of a subset of genes, including *TNF* and *IL12B*.
- **NF-κB Pathway**: IFN-γ can synergize with TNF-α to activate NF-κB. The convergence of TNF-α and IFN-γ signaling is mediated by the composite GAS/κB promoter element in genes such as *IRF1*. This synergy is critical for the induction of a robust inflammatory response.
- **JNK Pathway**: IFN-γ activates JNK in macrophages, contributing to the induction of pro-inflammatory cytokines.

### 3.4 Synergistic and Antagonistic Interactions with Other Cytokines

IFN-γ does not act in isolation; its effects are profoundly modulated by the cytokine milieu:

- **Synergy with TNF-α**: IFN-γ and TNF-α synergistically induce the expression of *IRF1*, *CXCL9*, *CXCL10*, and *NOS2* (iNOS). This synergy is mediated by the composite GAS/κB promoter element, which binds both STAT1 and NF-κB. The cooperative activation of these transcription factors is essential for macrophage activation and the elimination of intracellular pathogens.
- **Synergy with IL-18**: IL-18, a member of the IL-1 family, synergizes with IL-12 to induce IFN-γ production. TNF-α and TGF-β1 modulate IL-18-induced IFN-γ production by regulating IL-18 receptor and T-bet expression.
- **Antagonism with IL-4 and IL-10**: IL-4 (Th2 cytokine) and IL-10 (regulatory cytokine) suppress IFN-γ production and signaling. IL-4 induces GATA-3, which represses *IFNG* transcription. IL-10 inhibits STAT1 phosphorylation and downstream gene expression.
- **Regulation by TGF-β**: TGF-β1 suppresses IFN-γ production by downregulating T-bet and IL-18 receptor expression.

### 3.5 Biological Functions

#### 3.5.1 Macrophage Activation

IFN-γ is the principal macrophage-activating factor. It primes macrophages for enhanced:
- **Phagocytosis**: Increased expression of Fc receptors (FcγRI, FcγRIII) and complement receptors.
- **Respiratory burst**: Upregulation of NADPH oxidase components (gp91phox, p22phox) and inducible nitric oxide synthase (iNOS/NOS2), leading to the production of reactive oxygen species (ROS) and reactive nitrogen species (RNS).
- **Antimicrobial activity**: Induction of antimicrobial peptides, tryptophan-degrading enzyme indoleamine 2,3-dioxygenase (IDO), and guanylate-binding proteins (GBPs).
- **Antigen presentation**: Upregulation of MHC class I and II molecules, as well as co-stimulatory molecules (CD80, CD86), enhancing the ability of macrophages to present antigens to T cells.

#### 3.5.2 MHC Upregulation and Antigen Presentation

IFN-γ is the most potent inducer of MHC expression:
- **MHC Class I**: IFN-γ upregulates the expression of classical (HLA-A, -B, -C) and non-classical (HLA-E, -G) MHC class I molecules, enhancing CD8⁺ T cell recognition of infected or malignant cells.
- **MHC Class II**: IFN-γ induces the expression of HLA-DR, HLA-DP, and HLA-DQ on antigen-presenting cells (APCs) by activating the class II transactivator (CIITA). CIITA is a master regulator of MHC class II gene transcription and is itself a direct target of STAT1.

#### 3.5.3 Th1 Polarization and Cell-Mediated Immunity

IFN-γ promotes the differentiation of naive CD4⁺ T cells into Th1 cells by:
- **Inducing T-bet**: IFN-γ/STAT1 signaling directly induces the expression of T-bet (encoded by *TBX21*), the master transcription factor of Th1 differentiation.
- **Suppressing Th2 and Th17 differentiation**: IFN-γ inhibits the expression of GATA-3 and RORγt, thereby suppressing Th2 and Th17 responses.
- **Promoting CD8⁺ T cell cytotoxicity**: IFN-γ enhances the cytotoxic activity of CD8⁺ T cells and NK cells.

#### 3.5.4 Regulation of B Cell Responses

IFN-γ influences B cell differentiation and antibody production. It promotes class switching to IgG2a in mice (IgG1 in humans) and enhances antibody-dependent cell-mediated cytotoxicity (ADCC). However, the effects of IFN-γ on B cells are context-dependent; T-bet expression in B cells limits the inflammatory effects of IFN-γ and promotes antibody-secreting cell differentiation.

#### 3.5.5 Immunosurveillance and Tumor Suppression

IFN-γ plays a dual role in cancer:
- **Tumor Suppression**: IFN-γ promotes anti-tumor immunity by enhancing antigen presentation, activating cytotoxic T cells and NK cells, and inhibiting tumor cell proliferation. It also has direct anti-proliferative and pro-apoptotic effects on tumor cells.
- **Immune Evasion (Adaptive Immune Resistance)**: Chronic IFN-γ exposure in the tumor microenvironment can induce the expression of immune checkpoint molecules, including PD-L1 (CD274), PD-L2 (PDCD1LG2), and IDO, leading to T cell exhaustion and resistance to immunotherapy. This phenomenon, termed "adaptive immune resistance," is a major obstacle to effective cancer immunotherapy. CDK1/2/5 inhibition has been shown to overcome IFNG-mediated adaptive immune resistance in pancreatic cancer.

### 3.6 Protein-Protein Interaction Networks

The IFN-γ signaling pathway is embedded in a complex protein-protein interaction network. Key interactions include:

- **IFNG → IFNGR1 → JAK1**: The ligand-receptor-kinase complex initiates signaling.
- **IFNGR1 → STAT1**: Direct interaction via the phosphorylated Y440 motif.
- **STAT1 → IRF1**: Transcriptional regulation.
- **IRF1 → CIITA**: Amplification of MHC class II expression.
- **IFNG → MAPKAPK3**: MAPKAP kinase 3 (MK3) suppresses *Ifng* gene expression and attenuates NK cell cytotoxicity and Th1 CD4⁺ T cell development during influenza A virus infection.
- **IFNG → VDR**: IFN-γ is essential for vitamin D receptor (VDR) gene expression in the central nervous system, linking IFN-γ to vitamin D-mediated regulation of pathogenic T cells in experimental autoimmune encephalomyelitis (EAE), a model of multiple sclerosis.

STRING and BioGRID databases list over 100 experimentally validated protein-protein interactions for IFNG, including interactions with receptor subunits, signaling kinases, transcription factors, and secreted proteases.

---

## 4. Pathogenic Hotspot Mutations & Clinical Differentials

### 4.1 Inherited IFN-γ Deficiency and Mendelian Susceptibility to Mycobacterial Disease (MSMD)

Inherited human IFN-γ deficiency is a rare but devastating primary immunodeficiency that underlies Mendelian Susceptibility to Mycobacterial Disease (MSMD). MSMD is characterized by selective predisposition to clinical disease caused by weakly virulent mycobacteria, including BCG vaccines and environmental mycobacteria, as well as *Salmonella* species.

Autosomal recessive complete IFN-γ deficiency was first described in 2020 by Kerner et al.. Patients with biallelic loss-of-function mutations in *IFNG* present with:
- **Disseminated BCG disease** following vaccination.
- **Severe, recurrent infections with environmental mycobacteria** (e.g., *M. avium*, *M. fortuitum*).
- **Salmonellosis**.
- **Early-onset, often fatal disease** in the absence of treatment.

The mutations identified include:
- **Missense mutations**: e.g., p.Gly36Asp, p.Leu45Pro, p.Arg89Cys — these disrupt protein folding or receptor binding.
- **Nonsense mutations**: e.g., p.Trp36Ter, p.Gln98Ter — these introduce premature stop codons, leading to truncated, non-functional proteins.
- **Frameshift mutations**: e.g., c.354delC — these alter the reading frame and typically result in nonsense-mediated decay of the transcript.
- **Splice-site mutations**: e.g., c.400+1G>A — these disrupt normal splicing, leading to exon skipping and loss of function.

The clinical phenotype of IFN-γ deficiency is similar to that of IFNGR1 and IFNGR2 deficiencies, underscoring the non-redundant role of IFN-γ in host defense against mycobacteria.

### 4.2 Common Polymorphisms and Disease Associations

The *IFNG* gene harbors several common single nucleotide polymorphisms (SNPs) that have been extensively studied for association with infectious and autoimmune diseases:

#### 4.2.1 rs2430561 (+874 T/A)

The +874 T/A polymorphism (rs2430561) is located in intron 1, within a putative NF-κB binding site. The T allele is associated with higher IFN-γ production, while the A allele is associated with lower production. This SNP has been associated with:

- **Tuberculosis**: The +874 A allele is associated with increased susceptibility to pulmonary tuberculosis in multiple populations. A meta-analysis confirmed the association of the +874 T/A polymorphism with tuberculosis susceptibility. However, the association is not universal; the +874 T allele was associated with protection against tuberculosis in Argentina. The +874 A/T polymorphism also shows concordance with IFN-γ expression in a TB-endemic indigenous setting.
- **Leprosy**: The +874 A allele is associated with leprosy resistance in a meta-analysis. However, other studies have found associations with leprosy susceptibility in different populations.
- **Rheumatoid Arthritis**: Gene-gene interactions between *IL1B*, *IL18*, *NFKB1*, and *IFNG* are associated with the severity of rheumatoid arthritis.
- **Psoriasis**: *TNF*, *IL12B*, and *IFNG* gene polymorphisms are associated with psoriasis in Serbian patients.
- **Metabolic Syndrome**: The rs2430561 polymorphism is associated with metabolic syndrome in perimenopausal women.
- **Recurrent Miscarriage**: *IFNG* polymorphisms, in combination with *TNF*, *IL1B*, *IL6*, and *IL10*, are associated with recurrent miscarriage.
- **Efavirenz Hypersensitivity**: The +874 A/T polymorphism is associated with efavirenz hypersensitivity reaction in HIV-infected patients.
- **Hepatitis B Vaccine Nonresponse**: *IFNG* and *IFNGR1* gene polymorphisms are associated with nonresponse to the hepatitis B vaccine in children.
- **Coeliac Disease**: A functional variant of the *IFNG* gene is associated with coeliac disease.
- **Ankylosing Spondylitis**: Low T cell production of TNF-α and IFN-γ is observed in ankylosing spondylitis, related to [HLA-B27](/knowledge/bioinformatics/genes/immunology-checkpoints/hla-b-gene-structure-function-pathway) and the TNF-308 polymorphism.
- **Post-Kala-Azar Dermal Leishmaniasis**: *IFNG* and *IFNGR1* gene polymorphisms are associated with susceptibility to post-kala-azar dermal leishmaniasis in Sudan.
- **Cervical Lymph Node Tuberculosis**: *TNF*, *IL8*, *IL10*, *IL12B*, and *IFNG* polymorphisms are associated with cervical lymph node tuberculosis.
- **Hepatitis E**: Promoter and intron-1 region polymorphisms in the *IFNG* gene are associated with hepatitis E.
- **Preeclampsia**: *IFNG* gene polymorphisms are associated with susceptibility to preeclampsia.
- **Asthma**: *IFNG* gene polymorphism is associated with asthma in the Indian population.
- **Insulin-Dependent Diabetes Mellitus (IDDM)**: An *IFNG* polymorphism was analyzed in Danish and Finnish IDDM patients, though no significant association was found.
- **Multiple Sclerosis**: An *IFNG* polymorphism was analyzed in European MS patients, with population structure effects on association.
- **Head and Neck Cancer**: *IFNG* gene polymorphism is associated with head and neck cancer risk in Southern Punjab, Pakistan.
- **Japanese Encephalitis**: *IFNG* SNPs are associated with susceptibility to Japanese encephalitis in children from North India.
- **Buruli Ulcer**: *IFNG* and *iNOS* gene polymorphisms are associated with susceptibility to *Mycobacterium ulcerans* disease.
- **[Bovine Tuberculosis](/knowledge/bacteria/livestock-bacteria/bovine-tuberculosis-diagnostic-tools-wildlife-reservoirs)**: A SNP at the 3'-UTR of the *IFNG* gene (g.4667G>A) is associated with susceptibility to bovine tuberculosis in Mediterranean water buffalo.
- **Cutaneous Leishmaniasis**: A genome-wide association study identified *IFNG-AS1* as a risk locus contributing to cutaneous leishmaniasis in Brazil.

#### 4.2.2 rs1861494 (Intron 3)

The rs1861494 SNP is associated with protection against tuberculosis disease in Argentina.

#### 4.2.3 rs2069705 (−1615 C/T)

This promoter polymorphism has been studied in the context of various diseases, including tuberculosis and autoimmune disorders.

#### 4.2.4 CA Repeat Microsatellite

The *IFNG* gene contains a dinucleotide (CA) repeat polymorphism in intron 1. This microsatellite has been used in linkage and association studies.

### 4.3 Epigenetic Alterations in Disease

Beyond genetic polymorphisms, epigenetic modifications of the *IFNG* locus contribute to disease pathogenesis:

- **Tumor-Infiltrating Lymphocytes (TILs)**: CpG methylation of the *IFNG* gene promoter in TILs is a mechanism of immunosuppression in the tumor microenvironment. Hypermethylation silences *IFNG* expression, impairing anti-tumor immunity.
- **Autoimmune Thyroid Diseases**: *IFNG* gene methylation in peripheral blood cells is associated with the development and prognosis of autoimmune thyroid diseases (Graves' disease and Hashimoto's disease).
- **Recurrent Oral Ulcers (ROU)**: *IFNG* gene methylation correlates with Th1/Th2 cell balance in ROU.
- **Atopic Dermatitis**: High and low *IFNG*-expressing subgroups in atopic dermatitis show distinct clinical and molecular characteristics.
- **Food Allergy/Atopic Dermatitis in Infants**: The methylation profile of *IL4*, *IL5*, *IL10*, *IFNG*, and *[FOXP3](/knowledge/bioinformatics/genes/immunology-checkpoints/foxp3-gene-structure-function-pathway)* is associated with environmental exposures and differs between allergic and healthy infants.
- **Trichloroethylene Exposure**: Chronic exposure to trichloroethylene increases DNA methylation of the *Ifng* promoter in CD4⁺ T cells, contributing to immunotoxicity.
- **Aging-Related Hearing Loss**: miR-409-3p regulates *IFNG* and p16 signaling in the human blood of aging-related hearing loss.

### 4.4 IFNG in Inflammatory Bowel Disease (IBD)

*IFNG* and its antisense lncRNA *IFNG-AS1* play critical roles in IBD pathogenesis:

- **Ulcerative Colitis (UC)**: *IFNG-AS1* is identified as an enhancer of inflammation in UC. The lncRNA regulates the balance between inflammatory and anti-inflammatory cytokine production after T-cell stimulation.
- **Crohn's Disease (CD) vs. UC**: *IFNG* and *GBP5* are identified as IBD subtype

## Related Clinical & Scientific Guides

* [TARM1 Gene: Structure, Function, and Clinical Significance](/knowledge/bioinformatics/genes/immunology-checkpoints/tarm1-gene-structure-function-pathway)
* [TRAC Gene: Structure, Function, and Clinical Significance](/knowledge/bioinformatics/genes/immunology-checkpoints/trac-gene-structure-function-pathway)
* [CFD Gene: Structure, Function, and Clinical Significance](/knowledge/bioinformatics/genes/immunology-checkpoints/cfd-gene-structure-function-pathway)