# How to Use Rosetta for Protein Structure Prediction: A Practical Tutorial for Beginners

Rosetta is a biomolecular modeling software suite used for protein structure prediction, docking, and design. This tutorial provides a practical pathway for graduate students and laboratory researchers who need to install Rosetta, run basic ab initio prediction and refinement protocols, and interpret output files without prior computational experience. The workflow described here focuses on command-line usage, file preparation, common parameter choices, and troubleshooting steps that produce usable models for downstream analysis.

## Scope and Reader Context

This tutorial assumes you have a working Linux or macOS system, basic familiarity with the command line, and a protein sequence of interest in FASTA format. You do not need prior experience with structural biology software or programming. The methods covered include installation, sequence preparation, ab initio structure prediction for small domains, refinement of existing models, and evaluation of output quality. The tutorial also addresses common failure modes and how to recognize when results are not reliable enough for publication or downstream experiments.

Rosetta is one of the regularly top-performing methods in the community-wide Critical Assessment of Structure Prediction experiments, and predictions for protein domains under 125 amino acids frequently achieve backbone root-mean-square deviation values better than 5.0 angstroms, with some cases reaching atomic-level accuracy below 2.5 angstroms [11]. These performance characteristics define what you can reasonably expect from the software and help you set realistic goals for your own prediction projects.

## What Rosetta Does and What It Does Not Do

Rosetta approaches protein structure prediction through a combination of fragment assembly, Monte Carlo sampling, and energy-based scoring. The software searches conformational space by assembling short peptide fragments from known protein structures and evaluating candidate models using an energy function that approximates the physical forces stabilizing protein folds. This method was originally developed for de novo structure prediction and remains one of the strongest approaches for this task [11].

The software suite extends beyond ab initio prediction. Rosetta includes protocols for molecular docking, homology modeling, protein design, and structure determination using sparse experimental data from NMR or EPR experiments [11]. Recent developments have added support for modeling lanthipeptides, a class of ribosomally synthesized and post-translationally modified peptides with antibacterial activity, enabling structure prediction and design for these molecules [8]. Antibody and antigen modeling protocols are also available, covering structure prediction, docking, and design strategies including glycan addition [10].

Rosetta does not automatically produce a correct structure from a sequence alone. The software generates candidate models and scores them, but the quality of the final prediction depends on sequence length, available homologous structures, the choice of protocol, and the number of sampling trajectories you run. For sequences longer than approximately 125 amino acids, ab initio prediction becomes substantially more difficult and may require experimental data or homology-based approaches to achieve reliable results [11].

## At a Glance

| Task | Recommended Protocol | Typical Input | Expected Output | Time Investment |
|------|---------------------|---------------|-----------------|-----------------|
| Install Rosetta | Download from Rosetta Commons, compile with scons | Source code, compiler toolchain | Executable binaries in `main/source/bin` | 1 to 3 hours |
| Ab initio prediction | `AbinitioRelax` application | FASTA sequence, fragment files, score function | Decoy PDB files, score file, silent file | 1 to 24 hours depending on decoy count |
| Refine existing model | `Relax` application | PDB file, constraint file, score function | Relaxed PDB file, score report | 30 minutes to several hours |
| Evaluate model quality | `score_jd2` or PyRosetta analysis scripts | PDB files, score function | Score table, per-residue metrics | Minutes |

## Installing Rosetta on Your System

### Obtaining the Software

Rosetta is distributed through the Rosetta Commons organization. Academic users can request a license through the Rosetta Commons licensing page, while commercial users follow a separate licensing pathway. The download package includes the full source code, documentation, and a collection of example files and protocols.

Before downloading, verify that your system meets the compilation requirements. Rosetta builds on Linux and macOS systems using the scons build system. You need a C++ compiler, Python, and several development libraries. The Rosetta documentation provides the current list of supported compilers and dependencies, and checking this list before starting saves time during the build process.

### Compilation Steps

After extracting the downloaded archive, navigate to the `main/source` directory and run the scons build command. The basic command compiles the core libraries and all applications:

```
cd rosetta/main/source
./scons.py -j 8 mode=release bin
```

The `-j` flag controls the number of parallel compilation jobs and should match the number of CPU cores available on your machine. The `mode=release` flag produces optimized binaries suitable for production runs, while `mode=debug` produces binaries with additional checks that run more slowly. For routine prediction work, use release mode.

Compilation typically takes one to three hours on a modern workstation. The resulting binaries appear in the `main/source/bin` directory with names like `abinitio_relax.default.linuxgccrelease`. The exact name depends on your operating system and compiler.

### Verifying the Installation

Run a simple test to confirm that the binaries work:

```
./main/source/bin/score_jd2.default.linuxgccrelease -in:file:s test.pdb
```

This command scores a PDB file and prints energy values to the screen. If the command runs without errors, the installation is functional. The Rosetta documentation includes additional test suites that exercise specific protocols, and running these tests after installation helps confirm that all components work correctly.

## Preparing Input Files for Structure Prediction

### Sequence File Format

Rosetta accepts protein sequences in FASTA format. Create a plain text file with the sequence header and the amino acid sequence:

```
>my_protein
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ
```

The sequence must use standard one-letter amino acid codes. Rosetta does not accept nucleotide sequences or nonstandard amino acids in standard ab initio protocols. For modified peptides such as lanthipeptides, Rosetta provides specialized modeling support that handles the post-translational modifications [8].

### Fragment File Generation

Ab initio prediction requires fragment files that describe local structural preferences for short segments of your sequence. Rosetta uses these fragments during assembly to sample plausible backbone conformations. The standard approach generates fragments using the Robetta server or the `make_fragments.pl` script included with Rosetta.

Fragment files come in two types: 3-residue fragments and 9-residue fragments. Both are required for the standard ab initio protocol. The fragment generation process searches the Protein Data Bank for structures with sequence similarity to each window of your protein and records the backbone torsion angles of the best matches.

The Rosetta documentation recommends generating at least 200 fragments per position for each fragment size. The fragment files use a specific format that Rosetta reads during the prediction run. If you use the Robetta server, the server returns the fragment files ready for use. If you generate fragments locally, verify that the files have the correct format before starting the prediction.

### Score Function Selection

Rosetta uses score functions to evaluate the energy of candidate models. The default score function for ab initio prediction is `ref2015`, which includes terms for van der Waals interactions, hydrogen bonding, solvation, and statistical preferences derived from known protein structures. The score function is specified with the `-score:weights` flag:

```
-score:weights ref2015
```

For refinement protocols, the `ref2015` score function is also the standard choice. Specialized applications may use modified score functions. For example, protocols that integrate mass spectrometry data use Rosetta scoring terms that account for covalent labeling, ion mobility, and surface-induced dissociation data [7]. These specialized score terms require additional setup and are not part of the basic tutorial workflow.

## Running Ab Initio Structure Prediction

### The AbinitioRelax Application

The primary application for ab initio prediction is `AbinitioRelax`, which combines fragment assembly with a final relaxation step that optimizes the model using the full energy function. The basic command structure is:

```
./main/source/bin/abinitio_relax.default.linuxgccrelease \
  -in:file:fasta my_protein.fasta \
  -in:file:frag3 my_protein_03_05.200_v1_3 \
  -in:file:frag9 my_protein_09_05.200_v1_3 \
  -abinitio:relax \
  -nstruct 1000 \
  -out:prefix my_protein_ \
  -out:file:silent my_protein_silent.out
```

The `-nstruct` flag controls the number of independent prediction trajectories. Each trajectory produces one model. For a first attempt, 1000 models is a reasonable starting point. The `-out:file:silent` flag writes models to a silent file, which is a compact binary format that stores multiple models in a single file.

### Understanding the Sampling Process

Each prediction trajectory performs a series of stages. The early stages use low-resolution scoring with fragment insertion to explore broad conformational space. Later stages gradually increase the resolution of the energy function and refine the model. The final relaxation step applies the full atomic-level energy function to optimize side-chain conformations and backbone geometry.

The number of trajectories determines how thoroughly Rosetta samples conformational space. More trajectories increase the chance of finding a low-energy model but require more computational time. For a 100-residue protein, 1000 trajectories might take several hours on a single processor. Running the calculation in parallel across multiple processors reduces the wall-clock time proportionally.

### Monitoring Progress

Rosetta writes progress information to the screen and to log files. The silent file accumulates models as they complete. You can monitor the number of completed models by checking the silent file size or by counting the number of model headers:

```
grep -c "SEQUENCE:" my_protein_silent.out
```

This command counts the number of models written so far. If the count does not increase over time, the calculation may have stalled or crashed. Check the log file for error messages.

## Refining an Existing Model

### When to Use Relax

The `Relax` application optimizes the geometry and energy of an existing model. Use Relax when you have a starting structure from homology modeling, experimental determination, or a previous prediction run and you want to improve its quality. Relax performs iterative cycles of side-chain repacking and backbone minimization to reduce the energy of the model while maintaining the overall fold.

The basic command is:

```
./main/source/bin/relax.default.linuxgccrelease \
  -in:file:s starting_model.pdb \
  -relax:fast \
  -nstruct 10 \
  -out:prefix relaxed_
```

The `-relax:fast` flag selects the fast relax protocol, which is appropriate for most refinement tasks. The `-nstruct` flag controls the number of independent relaxation trajectories. Running multiple trajectories and selecting the lowest-energy result provides more reliable refinement than a single run.

### Interpreting Relax Output

Relax produces one output PDB file per trajectory. The score of each model is printed to the screen and can be compared to identify the lowest-energy result. The total score is a useful metric for comparing models generated by the same protocol, but it is not an absolute measure of model quality. A lower score indicates a more favorable energy according to the Rosetta energy function, but the relationship between score and biological accuracy is not linear.

### Constrained Relaxation

When experimental data are available, Relax can incorporate constraints that guide the refinement toward models consistent with the data. For example, mass spectrometry data can provide information about solvent accessibility, collision cross sections, and interface strengths that can be converted into Rosetta constraints [7]. The constraint file is specified with the `-constraints:cst_file` flag:

```
-constraints:cst_file my_constraints.cst
```

The constraint format is documented in the Rosetta documentation. Using constraints requires careful validation because incorrect constraints can bias the refinement toward incorrect models.

## Evaluating Prediction Quality

### Score-Based Model Selection

After an ab initio prediction run, select the models with the lowest energy scores. The score file or silent file contains the energy of each model. For silent files, use the `extract_pdbs` application to convert selected models to PDB format:

```
./main/source/bin/extract_pdbs.default.linuxgccrelease \
  -in:file:silent my_protein_silent.out \
  -in:file:tags model_0001 model_0002 model_0003
```

The `-in:file:tags` flag specifies which models to extract by their tag names. The tag names are listed in the silent file header.

### Structural Metrics

Beyond the Rosetta energy score, evaluate models using structural metrics that relate to biological plausibility. The Rosetta energy function includes terms that penalize steric clashes, unsatisfied hydrogen bonds, and exposed hydrophobic residues. Models with poor values for these terms are likely to be incorrect.

For models generated with mass spectrometry data integration, additional metrics such as solvent accessibility and collision cross sections can be calculated and compared to experimental values [7]. Agreement between calculated and experimental values provides independent validation of model quality.

### Comparison to Known Structures

If a homologous structure exists, compare your predicted model to the known structure using root-mean-square deviation of backbone atoms. The PyMOL `align` command or the Rosetta `score_jd2` application with the `-rmsd` flag can calculate this value. A backbone RMSD below 5.0 angstroms for a domain under 125 amino acids is consistent with the performance expected from Rosetta ab initio prediction [11].

## Common Failure Patterns and Troubleshooting

### Installation Failures

Compilation errors most often result from missing dependencies or incompatible compiler versions. Check that all required development libraries are installed and that your compiler version is supported by the Rosetta build system. The Rosetta documentation lists supported compiler versions, and using an unsupported version frequently causes build failures.

### Fragment Generation Errors

Fragment generation can fail when the sequence has low complexity regions or when no homologous structures exist in the fragment database. Low-complexity regions produce fragments with poor structural preferences, which reduces prediction accuracy. If fragment generation fails, check the sequence for repeated amino acids or unusual composition.

### Poor Model Quality

Models with high energy scores or poor structural metrics indicate that the prediction did not converge to a plausible fold. Common causes include insufficient sampling, incorrect fragment files, and sequences that are too long for ab initio prediction. Increase the number of trajectories, verify the fragment files, and consider using homology-based methods for longer sequences.

### Silent File Corruption

Interrupted calculations can produce corrupted silent files. If the silent file cannot be read, check the file size and the last model header. Rosetta writes models incrementally, so models completed before the interruption should be recoverable. The `extract_pdbs` application can read partial silent files if the file structure is intact.

## Reproducibility and Record Keeping

### Setting Random Seeds

Rosetta uses random number generation during sampling. To reproduce a specific prediction run, set the random seed explicitly:

```
-constant_seed -jran 12345
```

The `-constant_seed` flag forces Rosetta to use the seed value provided by `-jran`. Recording the seed value in your laboratory notebook allows you to reproduce the exact same set of models.

### Documenting Protocol Parameters

Record all protocol parameters for each prediction run, including the Rosetta version, score function, fragment files, number of trajectories, and random seed. This information is essential for reproducing results and for reporting methods in publications. The Rosetta documentation and the broader bioinformatics training community emphasize the importance of reproducible workflows [2][5].

### File Organization

Organize prediction runs in directories that include the input files, parameter files, and output files. A typical directory structure is:

```
project/
  sequence/
    my_protein.fasta
  fragments/
    my_protein_03_05.200_v1_3
    my_protein_09_05.200_v1_3
  output/
    my_protein_silent.out
    scores.sc
  logs/
    run_20250115.log
```

This structure makes it straightforward to identify the inputs and parameters associated with each output file.

## Integrating Experimental Data

### Mass Spectrometry Data in Rosetta Workflows

Structural mass spectrometry data can be integrated into Rosetta prediction and refinement workflows to improve model accuracy. Covalent labeling data provides information about solvent accessibility, ion mobility data provides collision cross sections, and surface-induced dissociation data provides information about protein complex interfaces [7]. These data types are converted into Rosetta scoring terms or constraints that guide sampling toward models consistent with the experimental measurements.

The integration of energy-resolved mass spectrometry data has been shown to improve protein complex structure prediction. In a benchmark of 20 protein complexes, rescoring models based on agreement with experimental energy-resolved mass spectrometry data matched or improved the root-mean-square deviation of the best scoring model compared to standard Rosetta in 16 of 20 cases, with 4 cases improving to highly accurate structures below 5 angstroms [9]. This approach is available through Rosetta Commons with usage tutorials and test files [9].

### Antibody and Antigen Modeling

For antibody and antigen modeling projects, Rosetta provides protocols for structure prediction, docking, and design. These protocols include specialized steps for modeling the complementarity-determining regions of antibodies and for adding glycans to antigen structures [10]. The tutorials developed for the Rosetta workshop at Vanderbilt University provide detailed instructions for these workflows and are suitable for novice users [10].

### Lanthipeptide Modeling

Rosetta includes specialized support for modeling lanthipeptides, which are ribosomally synthesized peptides with post-translational modifications that include thioether cross-links. These modifications are essential for the antibacterial activity of lanthipeptides and must be represented correctly in structural models [8]. The Rosetta lanthipeptide modeling tools enable structure prediction and design for this class of molecules, addressing a gap in computational tools for these peptides [8].

## Limitations and Professional Escalation Criteria

### Sequence Length Limitations

Ab initio prediction with Rosetta is most reliable for protein domains under 125 amino acids [11]. For longer sequences, the conformational search space becomes too large for reliable sampling without additional information. If your protein exceeds this length, consider using homology modeling, experimental data, or deep learning methods such as AlphaFold2 as alternatives or complements to Rosetta ab initio prediction [7].

### When to Seek Expert Assistance

Consult a structural biology expert or the Rosetta community forums when you encounter any of the following situations:

- Prediction results are inconsistent across repeated runs with different random seeds
- The lowest-energy models have poor structural metrics that cannot be improved by increasing sampling
- You need to integrate experimental data types that are not covered by standard Rosetta protocols
- You are working with nonstandard amino acids or post-translational modifications beyond lanthipeptide cross-links
- You need to interpret results for regulatory or clinical applications

The Rosetta Commons community provides support through mailing lists and forums, and the documentation includes troubleshooting guidance for common issues.

### Validation Before Publication

Before using Rosetta models in a publication or downstream application, validate the models using independent methods. Compare predicted models to experimental data when available, and report the limitations of the prediction approach. The Rosetta energy score alone is not sufficient evidence of model correctness.

## Practical Workflow Summary

### Step 1: Prepare Your Sequence

Create a FASTA file with your protein sequence. Verify that the sequence uses standard amino acid codes and does not contain ambiguous characters.

### Step 2: Generate Fragments

Generate 3-residue and 9-residue fragment files using the Robetta server or the local fragment generation script. Verify that the fragment files contain the expected number of fragments.

### Step 3: Run Ab Initio Prediction

Run the `AbinitioRelax` application with your sequence, fragment files, and the `ref2015` score function. Start with 1000 trajectories and monitor progress.

### Step 4: Evaluate Models

Extract the lowest-energy models from the silent file and evaluate their structural metrics. Compare models to known structures when available.

### Step 5: Refine Selected Models

Run the `Relax` application on the best models to optimize their geometry. Compare the relaxed scores to the original scores.

### Step 6: Document and Archive

Record all parameters, file locations, and results. Archive the input files, output files, and logs in a structured directory.

## Records and Measurements

Maintain a laboratory notebook or electronic record for each prediction run. Include the following information:

- Rosetta version and build configuration
- Score function and any custom weights
- Fragment file names and generation method
- Number of trajectories and random seed
- Computational resources used and wall-clock time
- Output file locations and model selection criteria
- Final model scores and structural metrics

This record supports reproducibility and provides the information needed for methods sections in publications.

## Safety and Ethical Considerations

Rosetta is a computational tool and does not involve biological hazards. However, the results of structure prediction can inform experimental work with proteins that may be hazardous. If your predicted structures will guide experiments with pathogenic proteins or toxins, follow your institution's biosafety guidelines for the corresponding experimental work.

When using Rosetta for antibody or antigen design, consider the ethical implications of the designed molecules. Protein design can produce molecules with biological activity, and the intended use should be evaluated for safety and regulatory compliance before experimental implementation.

## Building a Decision Framework for Choosing Between Rosetta Protocols

When you first start using Rosetta, the range of available protocols can feel overwhelming. The previous sections covered installation, ab initio prediction, and refinement, but they did not address a critical question that every new user faces: how do you decide which protocol to use for your specific protein and research question? This section provides a practical decision framework that helps you match your problem to the appropriate Rosetta method before you invest computational time and effort.

### The Core Decision Tree for Rosetta Users

The decision process begins with three questions about your starting material and your goal. Answer these questions in order, and they will direct you to the appropriate protocol category.

**Question 1: What do you have as a starting point?**

You either have an amino acid sequence with no structural information, or you have an existing structural model. The first case points toward ab initio prediction or homology-based approaches. The second case points toward refinement, docking, or design protocols.

**Question 2: What is the length of your target protein?**

Sequence length is the single most important practical constraint in Rosetta structure prediction. Ab initio prediction performs reliably for domains under 125 amino acids, with backbone root-mean-square deviation values frequently better than 5.0 angstroms and some cases reaching atomic-level accuracy below 2.5 angstroms [11]. For longer sequences, the conformational search space expands dramatically, and ab initio methods become unreliable without additional experimental data or homology information.

**Question 3: What experimental data do you have available?**

If you have experimental data such as mass spectrometry measurements, NMR constraints, or cross-linking data, you can integrate these into Rosetta workflows to guide sampling and scoring. Structural mass spectrometry data, including covalent labeling, ion mobility, and surface-induced dissociation measurements, can be incorporated through Rosetta scoring terms and specialized applications [7]. The presence of such data changes both the protocol choice and the expected accuracy.

### Protocol Selection Matrix

The following matrix summarizes the recommended protocol for common research scenarios. Use this table as a quick reference when planning your first Rosetta run.

| Research Scenario | Recommended Protocol | Key Inputs | Expected Output Quality | Computational Cost |
|-------------------|---------------------|------------|------------------------|-------------------|
| Small domain under 125 residues, no homologs, no experimental data | AbinitioRelax | FASTA sequence, fragment files | Backbone RMSD 3 to 5 angstroms for easy folds | High, 1000+ trajectories |
| Small domain under 125 residues, homologous structure available | Comparative modeling with Relax | Sequence alignment, template PDB | Backbone RMSD 1 to 3 angstroms if template is close | Moderate |
| Protein over 125 residues, no homologs | Not suitable for ab initio alone | Consider AlphaFold2 or experimental data integration | Variable, often poor without data | Not recommended |
| Existing model needs geometric optimization | Relax | Starting PDB, score function | Improved local geometry, same overall fold | Low to moderate |
| Protein complex, subunits known | RosettaDock | Subunit structures, complex topology | Interface accuracy depends on data | Moderate to high |
| Antibody structure prediction | Antibody protocol | Sequence, framework template | CDR loop accuracy varies | Moderate |
| Lanthipeptide with post-translational modifications | Specialized lanthipeptide protocol | Sequence, modification map | Requires modification-aware modeling | Moderate |
| Model validation with mass spectrometry data | ERMS rescoring | Models, experimental ERMS data | Improved ranking of correct models | Low after model generation |

### Decision Rules for Common Situations

#### Rule 1: Sequence Length Below 125 Residues with No Homologs

Use AbinitioRelax with fragment files generated from your sequence. This is the classic use case for Rosetta and the one with the strongest performance record [11]. Generate at least 200 fragments per position for both 3-residue and 9-residue fragment files. Run 1000 trajectories as a first pass, then evaluate the energy distribution before deciding whether to increase sampling.

#### Rule 2: Sequence Length Below 125 Residues with a Homologous Structure

Do not start with ab initio prediction. Instead, build a comparative model using the homologous structure as a template, then refine the model with Relax. This approach is substantially more efficient and typically produces more accurate models than ab initio prediction when a good template exists. The Rosetta documentation provides protocols for comparative modeling that use sequence alignment information to thread your target sequence onto the template structure.

#### Rule 3: Sequence Length Above 125 Residues

Ab initio prediction is unlikely to produce reliable results for sequences above this length [11]. Your options are comparative modeling if a template exists, or integration with deep learning methods such as AlphaFold2. Recent tutorials demonstrate workflows that combine Rosetta refinement with AlphaFold2 models, using Rosetta to optimize and validate structures generated by deep learning approaches [7]. This hybrid strategy is often the most practical path for larger proteins.

#### Rule 4: You Have Mass Spectrometry Data

Mass spectrometry data can substantially improve model selection and refinement. Covalent labeling data provides solvent accessibility information, ion mobility data provides collision cross sections, and surface-induced dissociation data provides interface strength information for complexes [7]. These data types can be converted into Rosetta scoring terms or constraints. For protein complexes, energy-resolved mass spectrometry data has been shown to improve structure prediction. In a benchmark of 20 protein complexes, rescoring models based on agreement with experimental energy-resolved mass spectrometry data matched or improved the root-mean-square deviation of the best scoring model compared to standard Rosetta in 16 of 20 cases, with 4 cases improving to highly accurate structures below 5 angstroms [9].

#### Rule 5: You Are Working with Modified Peptides

Standard ab initio protocols do not handle post-translational modifications. If your peptide contains thioether cross-links or other modifications, use the specialized lanthipeptide modeling tools in Rosetta [8]. These tools represent the modifications correctly during structure prediction and design, which is essential for obtaining meaningful models of these molecules.

### Implementing the Decision Framework in Practice

#### Step 1: Create a Protocol Decision Record

Before running any Rosetta calculation, create a decision record that documents your answers to the three core questions. This record should include the sequence length, the availability of homologous structures, the presence of experimental data, and the protocol you selected based on these factors. This record serves two purposes: it forces you to think through the decision explicitly, and it provides documentation for your methods section later.

A practical decision record looks like this:

```
Protein: my_protein
Sequence length: 98 residues
Homologs identified: none in PDB
Experimental data: none
Protocol selected: AbinitioRelax
Rationale: Sequence under 125 residues, no template available
Date: 2025-01-15
```

#### Step 2: Check Your Decision Against Known Limitations

After selecting a protocol, verify that your choice is consistent with the documented limitations of Rosetta. If you selected ab initio prediction for a 200-residue protein, reconsider your approach. If you selected comparative modeling but have no identified template, you need to search for homologs more thoroughly or change your protocol.

The NCBI provides sequence search tools that can help you identify homologous structures before committing to a protocol [1]. A BLAST search against the Protein Data Bank sequences can reveal whether a template exists. If you find a homolog with significant sequence identity, comparative modeling is likely to outperform ab initio prediction.

#### Step 3: Estimate Computational Requirements

Different protocols have very different computational costs. Ab initio prediction with 1000 trajectories for a 100-residue protein can take several hours on a single processor. Relax refinement of a single model takes minutes to tens of minutes. Docking calculations vary widely depending on the size of the complex and the sampling parameters.

Estimate your computational requirements before starting. If you have access to a cluster or high-performance computing facility, you can parallelize trajectories across multiple processors. The Rosetta documentation describes how to distribute calculations across multiple cores or nodes. For a first attempt, start with a smaller number of trajectories to test the workflow, then scale up once you confirm that the protocol runs correctly.

#### Step 4: Define Success Criteria Before Running

Decide in advance what constitutes a successful prediction for your project. This decision prevents you from rationalizing poor results after the fact. Reasonable success criteria include:

- The lowest-energy models cluster into a consistent fold
- The models have acceptable structural metrics such as few steric clashes and satisfied hydrogen bonds
- The models agree with any available experimental data
- The models are consistent with known biochemical properties of the protein

Write these criteria in your decision record before launching the calculation. After the run completes, evaluate the results against these criteria instead of against your hopes for the outcome.

### Troubleshooting Protocol Selection Errors

#### Symptom: Ab Initio Prediction Produces No Low-Energy Models

If your ab initio run produces models with uniformly high energies and no clear low-energy population, the protocol may be inappropriate for your sequence. Check the sequence length first. If the sequence is over 125 residues, switch to comparative modeling or a hybrid approach with AlphaFold2 [7]. If the sequence is short but the results are poor, check the fragment files for quality and consider generating new fragments with different parameters.

#### Symptom: Relax Does Not Improve the Model Score

Relax optimizes local geometry but does not change the overall fold. If your starting model has a fundamentally incorrect topology, Relax will not fix it. The relaxed model will have a lower energy than the starting model, but the energy may still be high compared to models with the correct fold. If Relax does not produce models with competitive scores, the starting model is likely incorrect, and you should revisit the modeling approach.

#### Symptom: Docking Results Are Inconsistent Across Runs

Docking protocols sample the interface between two proteins, and the results depend heavily on the starting conformations and the sampling parameters. If repeated docking runs with different random seeds produce very different top-scoring complexes, the docking calculation is not converging. Consider whether you have experimental data that can constrain the docking. Surface-induced dissociation data provides interface strength information that can guide multimeric structure determination [9]. Incorporating such data into the scoring can improve the consistency and accuracy of docking results.

#### Symptom: Models Do Not Agree with Experimental Data

If your models consistently disagree with experimental measurements, the scoring function may not be appropriate for your system, or the experimental data may not have been converted correctly into Rosetta constraints. Review the constraint conversion process carefully. The Rosetta documentation provides detailed instructions for converting mass spectrometry data into scoring terms [7]. If the conversion is correct and the disagreement persists, consider whether the experimental data themselves are consistent with a single structure or whether the protein samples multiple conformations.

### Building a Protocol Decision Log for Your Laboratory

A protocol decision log is a practical tool that records the decisions you make for each modeling project. This log is distinct from the general laboratory notebook because it focuses specifically on the rationale for protocol selection and the outcomes of that selection. Over time, this log becomes a valuable reference for future projects.

The log should include the following fields for each project:

- Project identifier and date
- Protein name and sequence length
- Homolog search results and template availability
- Experimental data inventory
- Protocol selected and rationale
- Computational resources used
- Success criteria defined before the run
- Actual outcomes and whether success criteria were met
- Lessons learned and potential protocol changes for future runs

Maintaining this log serves several purposes. It documents your decision process for publications and reproducibility. It helps you identify patterns in which protocols work well for which types of proteins. It also provides a basis for consulting with experts when you encounter problems, because you can present a clear record of what you tried and why.

### Integrating the Decision Framework with Reproducible Workflow Practices

The decision framework described here complements the reproducibility practices covered in the earlier section on record keeping. The bioinformatics training community emphasizes the importance of reproducible workflows, and the Galaxy Training Network provides accessible tutorials for analysis workflows that can be applied to structural biology [4]. The nf-core documentation describes community pipeline standards that emphasize reproducibility through version control and containerization [5].

For Rosetta work, reproducibility means more than recording parameters. It means documenting the decision process that led to those parameters. A reviewer or collaborator should be able to understand why you chose ab initio prediction over comparative modeling, why you used 1000 trajectories instead of 5000, and why you selected a particular score function. The decision record provides this context.

The Carpentries lessons on shell and Git provide foundational skills that support reproducible computational work [6]. Version control for your Rosetta input files, parameter files, and analysis scripts ensures that you can reconstruct exactly what you ran. The decision log adds the reasoning layer that version control alone cannot capture.

### When to Escalate to Expert Consultation

The decision framework resolves many common situations, but some cases require expert input. Escalate to a structural biology expert or the Rosetta community when you encounter any of the following situations:

- Your protein has unusual features such as nonstandard amino acids, extensive post-translational modifications, or intrinsically disordered regions that standard protocols do not handle
- You need to integrate multiple experimental data types simultaneously and the integration is not covered by documented workflows
- Your prediction results are inconsistent across repeated runs with different random seeds and you cannot identify the cause
- You are working on a protein complex with more than two subunits and the docking protocol is not producing consistent results
- You need to interpret results for regulatory or clinical applications where the consequences of an incorrect model are significant

The Rosetta Commons community provides support through mailing lists and forums. When posting questions, include your decision record, the exact commands you ran, and the output files. This information allows community members to diagnose problems efficiently.

### Practical Example: Applying the Decision Framework

Consider a graduate student who needs to model a 90-residue bacterial protein with no known homologs and no experimental data. The decision framework directs this student to AbinitioRelax with fragment files generated from the sequence. The student creates a decision record documenting the sequence length, the absence of homologs, and the absence of experimental data. The student defines success criteria: the lowest-energy models should cluster into a consistent fold, and the models should have acceptable structural metrics.

The student runs 1000 trajectories and evaluates the results. The energy distribution shows a clear low-energy population, and the lowest-energy models share a common fold. The structural metrics are acceptable. The student documents the results in the decision log and proceeds with the models for downstream analysis.

Contrast this with a second student who needs to model a 300-residue protein with no homologs. The decision framework directs this student away from ab initio prediction because the sequence exceeds the reliable range [11]. The student instead uses AlphaFold2 to generate an initial model and then uses Rosetta Relax to refine it. The student documents this hybrid approach in the decision record and notes that the Rosetta refinement improves the local geometry of the AlphaFold2 model.

These two examples illustrate how the decision framework prevents wasted computational effort and guides users toward protocols that are appropriate for their specific situations.

### Common Mistakes in Protocol Selection

#### Mistake 1: Using Ab Initio Prediction for Long Sequences

This is the most common mistake new users make. The appeal of predicting a structure from sequence alone is strong, but the conformational search space for a 300-residue protein is astronomically large. Rosetta ab initio prediction is designed for small domains, and using it for larger proteins wastes computational resources and produces unreliable results [11].

#### Mistake 2: Ignoring Available Experimental Data

If you have mass spectrometry data, NMR constraints, or other experimental information, use it. Experimental data can dramatically improve the accuracy of structure prediction by constraining the conformational search [7][9]. Ignoring available data because you want to test the pure prediction capability of Rosetta is a research choice, but it is not the most efficient path to an accurate model.

#### Mistake 3: Using Standard Protocols for Modified Peptides

Standard Rosetta protocols do not handle post-translational modifications. If you are working with lanthipeptides or other modified peptides, you must use the specialized modeling tools [8]. Using standard protocols will produce models that do not represent the actual molecule.

#### Mistake 4: Skipping the Homolog Search

A quick BLAST search against the Protein Data Bank can reveal a homologous structure that makes ab initio prediction unnecessary [1]. Comparative modeling from a good template is faster and more accurate than ab initio prediction. Skipping this search and going straight to ab initio prediction is a common inefficiency.

#### Mistake 5: Not Defining Success Criteria in Advance

Without predefined success criteria, it is too easy to rationalize poor results. Define what constitutes a successful prediction before you run the calculation, and evaluate the results against those criteria objectively.

### Summary of the Decision Framework

The decision framework presented here provides a structured approach to protocol selection in Rosetta. The three core questions about starting material, sequence length, and experimental data availability direct you to the appropriate protocol category. The protocol selection matrix summarizes the recommended approaches for common scenarios. The decision record and decision log provide documentation for reproducibility and future reference.

This framework does not replace the detailed protocol documentation in the Rosetta manual or the guidance available from the Rosetta community. It provides the strategic layer that helps new users avoid common mistakes and invest their computational resources wisely. By applying this framework before running any Rosetta calculation, you will produce more reliable models and develop a clearer understanding of when and how to use each Rosetta protocol.

## Frequently Asked Questions

### What is the minimum computational requirement to run Rosetta?

Rosetta runs on a standard Linux or macOS workstation with at least 8 GB of RAM and multiple CPU cores. A single ab initio prediction with 1000 trajectories for a 100-residue protein can take several hours on one processor, so using multiple cores reduces the wait time. The compilation step requires approximately 10 GB of disk space and a C++ compiler toolchain.

### How many models should I generate for ab initio prediction?

Start with 1000 models for a first attempt. If the lowest-energy models have poor structural metrics or if the energy distribution does not show a clear low-energy population, increase the number to 5000 or more. The optimal number depends on the sequence length and the difficulty of the fold.

### Can Rosetta predict the structure of any protein?

No. Rosetta ab initio prediction is most reliable for protein domains under 125 amino acids [11]. For longer proteins, homology modeling or deep learning methods are more appropriate. Rosetta can also use experimental data to guide prediction for larger systems [7].

### How do I know if my predicted structure is correct?

Compare the predicted model to experimental data when available. Check the Rosetta energy score, structural metrics such as clash counts and unsatisfied hydrogen bonds, and agreement with any experimental constraints. If a homologous structure exists, calculate the backbone root-mean-square deviation between the prediction and the known structure.

### What is the difference between ab initio prediction and refinement?

Ab initio prediction starts from the amino acid sequence alone and samples conformational space to find the lowest-energy fold. Refinement starts from an existing model and optimizes its geometry using the Rosetta energy function. Refinement does not change the overall fold but improves local geometry and side-chain conformations.

### Can I use Rosetta to model protein complexes?

Yes. Rosetta includes docking protocols for modeling protein-protein complexes. The docking protocols can be combined with experimental data such as mass spectrometry data to improve accuracy [7][9]. Antibody-antigen docking is a specific application with dedicated protocols [10].

### How do I incorporate experimental data into Rosetta?

Experimental data are converted into constraints or scoring terms that Rosetta uses during sampling or rescoring. The specific format depends on the data type. Mass spectrometry data such as covalent labeling, ion mobility, and surface-induced dissociation data have documented integration workflows [7]. The Rosetta documentation provides the constraint file format and scoring term specifications.

### What should I do if my prediction results look wrong?

Check the input files for errors, particularly the fragment files and sequence file. Increase the number of trajectories to improve sampling. Verify that the score function is specified correctly. If the results remain poor, consider using a different method such as homology modeling or AlphaFold2, and consult the Rosetta community for guidance.

## Related Bioinformatics Guides

- [How To Use Alphafold To Predict Structure: Structural Analysis and Computational Methodologies in Bioinformatics](/knowledge/bioinformatics/how-to-use-alphafold-to-predict-structure)
- [Conformational Sampling Algorithms in Protein Structure Prediction](/knowledge/bioinformatics/conformational-sampling-algorithms-in-protein-structure-prediction)
- [Protein Language Models in Bioinformatics: A Practical Guide to Selection and Application](/knowledge/bioinformatics/protein-language-models-in-bioinformatics-a-practical-guide-to-selection-and-application)
- [Gene Set Enrichment Analysis in R: A Practical Tutorial for Interpreting Omics Data](/knowledge/bioinformatics/gene-set-enrichment-analysis-in-r-a-practical-tutorial-for-interpreting-omics-data)
- [AlphaFold and Beyond: Deep Learning for Protein Structure Prediction in Veterinary Virology](/knowledge/bioinformatics/alphafold-deep-learning-protein-structure-prediction-veterinary-virology)

## References and Further Reading

- [NCBI Data Resources](https://www.ncbi.nlm.nih.gov/). National Center for Biotechnology Information.
- [EMBL-EBI Training](https://www.ebi.ac.uk/training). European Bioinformatics Institute.
- [Bioconductor](https://bioconductor.org/). Bioconductor Project.
- [Galaxy Training Network](https://training.galaxyproject.org/). Galaxy Project.
- [nf-core Documentation](https://nf-co.re/docs). nf-core.
- [The Carpentries Lessons](https://carpentries.org/lessons). The Carpentries.
- [Comprehensive Tutorial for Computational Methods of Protein Structure Prediction Incorporating Mass Spectrometry Data.](https://pubmed.ncbi.nlm.nih.gov/42415383). Mass spectrometry reviews, 2026.
- [Lanthipeptide structure prediction and design with Rosetta.](https://pubmed.ncbi.nlm.nih.gov/42177059). Methods in enzymology, 2026.
- [Energy Resolved Mass Spectrometry Data from Surfaced Induced Dissociation Improves Prediction of Protein Complex Structure.](https://pubmed.ncbi.nlm.nih.gov/39854242). Analytical chemistry, 2025.
- [Modeling Immunity with Rosetta: Methods for Antibody and Antigen Design.](https://pubmed.ncbi.nlm.nih.gov/33705117). Biochemistry, 2021.
- [Practically useful: what the Rosetta protein modeling suite can do for you.](https://pubmed.ncbi.nlm.nih.gov/20235548). Biochemistry, 2010.

> This article is educational and does not replace validated analysis plans, institutional policy, clinical interpretation, or specialist review.